Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000078891 (BX890623.7-201)
Chromosomal location
Chr 2: 175593640 - 175605309 (-)
Description
Novel KRAB box and zinc finger, C2H2 type domain containing protein  [Source:UniProtKB/TrEMBL;Acc:B1AYE1]
Uniprot/SPTREMBL
B1AYE1 Q3V498 
Human Ortholog
ENSG00000214197 (AC008770.7-203)
Omim not available
UniTrap UNI4716
Vector Insertion
Chr 2: 175597290 - 175605171
Public Clones XS0101 (sanger) XK272 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25083
Vector Insertion
Chr 2: 175596952 - 175597162
Public Clones not available
Private Clones OST195737 (lexicon) OST182194 (lexicon) OST61530 (lexicon)
Severity of mutation (?) Insertion after 56% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000109033
Sequence
AACTCAGCAGTCATGAGAGTTTCTGTGTGATGTGTTATGCGTGACTCTACTGGGTGTTGTGAGAGGAGGTTAGTCAAGCTCAGAACTCCAAACATG - U

NI4716 - GATTTAGTCACCTATGATGACGTGCATGTGAACTTCACTCAGGAAGAGTGGGCTTTGCTGGATGCTTCTCAGAAGAGTCTCTACAAAGGTG

TGATGGTAGAGACCTATAGGAATCTCACAGCTATAG - UNI25083 - GTTACAGTTGGGAAGAACATACAATTGAAGACCATTTCCAAACTTCTAGA

AGTCATGGAAG ATTCTCAAATCTTCATCATTATGAAAGAGAAACCCTATAA
Translation
M - UNI4716 - DLVTYDDVHVNFTQEEWALLDASQKSLYKGVMVETYRNLTAIG - UNI25083 - GYSWEEHTIEDHFQTSRSHGR RFSNLHH

YERETL
Transcript ENSMUST00000109032
Sequence
GGAGGCGGTTCTTCCGGGTCAAGCTTGCAAGCTCCTTTCTGTAACTCAGCAGTCATGAGAGTTTCTGTGTGATGTGTTATGCGTGACTCTACTGGGTGTT

GTGAGAGGAGGTTAGTCAAGCTCAGAACTCCAAACATG - UNI4716 - - UNI25083 - GTTACAGTTGGGAAGAACATACAATTGAAGACCATT

TCCAAACTTCTAGAAGTCATGGAAG CCTTTGCAGGAAGGAGTGACCTCCAAAGACAAAAGATCATACAGAAGAGAAAGTCTATGAAGGCATCTAATGTT

ATAAAGTCTTTGCAGCAAGCATTGATCTCCACGTATATAAATGAACACATACCAGAGAGGAACCTTTTAAATGTAACCAACATGGTAAAGCTTTTTCAAA

AACCAATAGTCTTTACATACATAAAAGAATATATACTTGAGAGAAATGCTTTGACTTTAACCAATGTGGTTAAACTTTTTCAGAAAGCAGTCATCAACAA

AATCATAAAACAACACGTATAG
Translation
MRDSTGCCERRLVKLRTPNM - UNI4716 - - UNI25083 - VTVGKNIQLKTISKLLEVMEA AFAGRSDLQRQKIIQKRKSMKASNVIKSLQQA

LISTYINEHIPERNLLNVTNMVKLFQKPIVFTYIKEYILERNALTLTNVVKLFQKAVINKIIKQHV

For any suggestions or comments, please send an email to unitrap@crg.es