Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000078893 (BX890623.7-202)
Chromosomal location
Chr 2: 175541264 - 175553148 (+)
Description
Novel KRAB box and zinc finger, C2H2 type domain containing protein  [Source:UniProtKB/TrEMBL;Acc:A2ARL5]
UniGene
Mm.462127 
Uniprot/SPTREMBL
A2ARL5 A2BG90 
Human Ortholog
not available
Omim not available
UniTrap UNI24596
Vector Insertion
Chr 2: 175541408 - 175544861
Public Clones IST11322H9 (tigm) IST12687H12 (tigm)
Private Clones OST213820 (lexicon) OST41879 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7596
Vector Insertion
Chr 2: 175544913 - 175544917
Public Clones RRR431 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15567
Vector Insertion
Chr 2: 175544917 - 175550041
Public Clones (sanger) PST2235-NR (escells) IST10609A12 (tigm) IST14673B4 (tigm)
IST14639G11 (tigm) IST14682F4 (tigm) IST14476B4 (tigm) IST14277D5 (tigm)
IST10895E3 (tigm) IST15028B6 (tigm) IST14658C4 (tigm) IST14493A1 (tigm)
IST11027D11 (tigm)
Private Clones OST466289 (lexicon) OST456421 (lexicon) OST286081 (lexicon) OST244103 (lexicon)
OST238018 (lexicon) OST114312 (lexicon) OST36715 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25761
Vector Insertion
Chr 2: 175550374 - 175550436
Public Clones not available
Private Clones OST167318 (lexicon) OST66143 (lexicon)
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27600
Vector Insertion
Chr 2: 175551590 - 175553149
Public Clones not available
Private Clones OST55718 (lexicon)
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000109038
Sequence
AGAAGAGGAGGCGGTTCTTCCGGGTCAAGCTTGCAAGCTCCTTTCTGTAACTCAGCAGTCATGAGAGTTTCTGTGTGATGTGTTCTGCGTGACTCTACTG

GGTGTTGTGAGAGGAGGTTAGTCAAGCTCAGAACTCCAAACATG - UNI24596 - TGTCTTCGCTGGATGCTGTGAATTTAGCTCAAGCAAGCTCAG

AACTTCACACATG - UNI7596 - - UNI15567 - GATTTAGTCACCTATGATGACGTGCAGGTGAACTTCACTCAGGATGAGTGGGCTTTGCTGG

ATCCTTCTCAGAAGAGTCTCTACAAGGGTGTGATGCTAGAGACCTATAGGAATCTCACAGCTATAG - UNI25761 - GTTACATTTGGGAAGAACAT

ACGATTGAAGACCATTTTCAAACTTCTCGAAGTCATGGAAG - UNI25761 - - UNI27600 - GCATGAAAGAAGTTGTTCTCCAGAGCAACCCT

CTGACTTTATTCAATGTGGTAAAGCCTTTGCATATGAGAGTGGTAGACAAAGGCATCAAATTAAACATAATGGAGAGAAACACCATGACTGTAACCAATG

TGGTAAGGACTTTAGAACATGGAATGTCCTGCAAATACATAAGCGAACACATACAGGAGAGAAACCCTATGACTGTAAACAATGTGGTAAAGTCTTTGCA

AGAAGCTGTCATCTCCAAATACATAATCAAACACATGCAGGAGAGAAACAGTATGAATGTAACCAATGTGGTAAAGCTTTTGAAAGAAGGAGTCACCTCC

AAATACATAAGCGAACACATACAGGAGAGAAACCCTATGAATGTAACCAATGTGGAAAAGCCTTTGCAAGAAGTGGTGTCCTCCAAAAACATAAACGAAC

ACATACAGGAGAGAAACCCTATGAATGTAAACAATGTGGTAAAGCCTTTGCAGTAATCTCTACTCTCCAAATGCATAAGCGAACACATACAGGAGCCAAA

CCCTATGAATGTAAACAATGTGGTAAAGCCTTTGCAGTAATCTATACTCTCCAAAGGCATAAGCAAACACATACAGGAGAGAAACCCTATAAATGTAAAC

AATGTGGTAAAACCTTTGCACGAAGCAGTCATCTCCGAATACATAAGCGAACACATACAGGAGAGAAACCCTATGAATGTAAACAATGTGGAAAAGCTTT

TGCAAGAAGTGGTGTACTCCAAGAACATAAACGCACACATACAGGAGAGAAACCCTATGAATGTAAACAATGTGGTAAAGCCTTTGCACAAAGCAGTCAT

CTCCGAATACATAAGCGAACACATACAGGAGAGAAACCCTATGAATGTAACCAATGTGGAAAAGCCTTTGCAAGAAGTGGTGACCTCCAACAACATAAAC

GAACACATACAGGAGAGAAACCCTATGAATGTAAACAATGTGGTAAAGCCTTTGCACAAAGCAGTCATCTCCGAATACATAAGCGAACACATACAGGAGA

GAAACCCTATGAATGTAACCAATGTGGAAAAGCCTTTGCAAGAAGTGATGACCTCCAAAAACATAAACGAACACATACAGGAGAGAAACCCTATGAATGT

AAACAATGTGGTAAAGCCTTTGCACATAGCAGTCATCTCCACAAACATGAGCGAACACATACAGGAGACAAACCCTATGAATGTAACCAATGTGGTAAAG

CCTTTGCAGAAAGCAGTACTCTCCAAATCCATAACCGAACACATACAGGAGACAAACCCTATGAATGTAACCAATGTGGTAAAGCCTTTGCAGTAATCTC

TACTCTCCAAATGCATAACCGAACACATACAGGAGAGAAACCCTATAAATGTAAACAATGTGGTAAAGCCTTTGCACAAAGCAGTCATCTCCGAATACAT

AAGCGAACACATACAGGAGAGAAACCCTATGAATGTAAACAATGTGGTAAAGCTTTTGCACAAAGCAGTCATCTCCGAATACATAAGCAAACACATACAG

GAGAGAGACCCTATGAATGTAACTAG
Translation
 - UNI24596 - M - UNI7596 - - UNI15567 - DLVTYDDVQVNFTQDEWALLDPSQKSLYKGVMLETYRNLTAIG - UNI25761 - GY

IWEEHTIEDHFQTSRSHGR - UNI25761 - - UNI27600 - RHERSCSPEQPSDFIQCGKAFAYESGRQRHQIKHNGEKHHDCNQCGKDFRTWNV

LQIHKRTHTGEKPYDCKQCGKVFARSCHLQIHNQTHAGEKQYECNQCGKAFERRSHLQIHKRTHTGEKPYECNQCGKAFARSGVLQKHKRTHTGEKPYEC

KQCGKAFAVISTLQMHKRTHTGAKPYECKQCGKAFAVIYTLQRHKQTHTGEKPYKCKQCGKTFARSSHLRIHKRTHTGEKPYECKQCGKAFARSGVLQEH

KRTHTGEKPYECKQCGKAFAQSSHLRIHKRTHTGEKPYECNQCGKAFARSGDLQQHKRTHTGEKPYECKQCGKAFAQSSHLRIHKRTHTGEKPYECNQCG

KAFARSDDLQKHKRTHTGEKPYECKQCGKAFAHSSHLHKHERTHTGDKPYECNQCGKAFAESSTLQIHNRTHTGDKPYECNQCGKAFAVISTLQMHNRTH

TGEKPYKCKQCGKAFAQSSHLRIHKRTHTGEKPYECKQCGKAFAQSSHLRIHKQTHTGERPYECN
Transcript ENSMUST00000109037
Sequence
ATG - UNI7596 - - UNI15567 - GATTTAGTCACCTATGATGACGTGCAGGTGAACTTCACTCAGGATGAGTGGGCTTTGCTGGATCCTTCTCA

GAAGAGTCTCTACAAGGGTGTGATGCTAGAGACCTATAGGAATCTCACAGCTATAG - UNI25761 - GTTACATTTGGGAAGAACATACGATTGAAG

ACCATTTTCAAACTTCTCGAAGTCATGGAAG - UNI25761 - - UNI27600 - GCATGAAAGAAGTTGTTCTCCAGAGCAACCCTCTGACTTTAT

TCAATGTGGTAAAGCCTTTGCATATGAGAGTGGTAGACAAAGGCATCAAATTAAACATAATGGAGAGAAACACCATGACTGTAACCAATGTGGTAAGGAC

TTTAGAACATGGAATGTCCTGCAAATACATAAGCGAACACATACAGGAGAGAAACCCTATGACTGTAAACAATGTGGTAAAGTCTTTGCAAGAAGCTGTC

ATCTCCAAATACATAATCAAACACATGCAGGAGAGAAACAGTATGAATGTAACCAATGTGGTAAAGCTTTTGAAAGAAGGAGTCACCTCCAAATACATAA

GCGAACACATACAGGAGAGAAACCCTATGAATGTAACCAATGTGGAAAAGCCTTTGCAAGAAGTGGTGTCCTCCAAAAACATAAACGAACACATACAGGA

GAGAAACCCTATGAATGTAAACAATGTGGTAAAGCCTTTGCAGTAATCTCTACTCTCCAAATGCATAAGCGAACACATACAGGAGCCAAACCCTATGAAT

GTAAACAATGTGGTAAAGCCTTTGCAGTAATCTATACTCTCCAAAGGCATAAGCAAACACATACAGGAGAGAAACCCTATAAATGTAAACAATGTGGTAA

AACCTTTGCACGAAGCAGTCATCTCCGAATACATAAGCGAACACATACAGGAGAGAAACCCTATGAATGTAAACAATGTGGAAAAGCTTTTGCAAGAAGT

GGTGTACTCCAAGAACATAAACGCACACATACAGGAGAGAAACCCTATGAATGTAAACAATGTGGTAAAGCCTTTGCACAAAGCAGTCATCTCCGAATAC

ATAAGCGAACACATACAGGAGAGAAACCCTATGAATGTAACCAATGTGGAAAAGCCTTTGCAAGAAGTGGTGACCTCCAACAACATAAACGAACACATAC

AGGAGAGAAACCCTATGAATGTAAACAATGTGGTAAAGCCTTTGCACAAAGCAGTCATCTCCGAATACATAAGCGAACACATACAGGAGAGAAACCCTAT

GAATGTAACCAATGTGGAAAAGCCTTTGCAAGAAGTGATGACCTCCAAAAACATAAACGAACACATACAGGAGAGAAACCCTATGAATGTAAACAATGTG

GTAAAGCCTTTGCACATAGCAGTCATCTCCACAAACATGAGCGAACACATACAGGAGACAAACCCTATGAATGTAACCAATGTGGTAAAGCCTTTGCAGA

AAGCAGTACTCTCCAAATCCATAACCGAACACATACAGGAGACAAACCCTATGAATGTAACCAATGTGGTAAAGCCTTTGCAGTAATCTCTACTCTCCAA

ATGCATAACCGAACACATACAGGAGAGAAACCCTATAAATGTAAACAATGTGGTAAAGCCTTTGCACAAAGCAGTCATCTCCGAATACATAAGCGAACAC

ATACAGGAGAGAAACCCTATGAATGTAAACAATGTGGTAAAGCTTTTGCACAAAGCAGTCATCTCCGAATACATAAGCAAACACATACAGGAGAGAGACC

CTATGAATGTAACTAG
Translation
M - UNI7596 - - UNI15567 - DLVTYDDVQVNFTQDEWALLDPSQKSLYKGVMLETYRNLTAIG - UNI25761 - GYIWEEHTIEDHFQTS

RSHGR - UNI25761 - - UNI27600 - RHERSCSPEQPSDFIQCGKAFAYESGRQRHQIKHNGEKHHDCNQCGKDFRTWNVLQIHKRTHTGEKPY

DCKQCGKVFARSCHLQIHNQTHAGEKQYECNQCGKAFERRSHLQIHKRTHTGEKPYECNQCGKAFARSGVLQKHKRTHTGEKPYECKQCGKAFAVISTLQ

MHKRTHTGAKPYECKQCGKAFAVIYTLQRHKQTHTGEKPYKCKQCGKTFARSSHLRIHKRTHTGEKPYECKQCGKAFARSGVLQEHKRTHTGEKPYECKQ

CGKAFAQSSHLRIHKRTHTGEKPYECNQCGKAFARSGDLQQHKRTHTGEKPYECKQCGKAFAQSSHLRIHKRTHTGEKPYECNQCGKAFARSDDLQKHKR

THTGEKPYECKQCGKAFAHSSHLHKHERTHTGDKPYECNQCGKAFAESSTLQIHNRTHTGDKPYECNQCGKAFAVISTLQMHNRTHTGEKPYKCKQCGKA

FAQSSHLRIHKRTHTGEKPYECKQCGKAFAQSSHLRIHKQTHTGERPYECN
Transcript ENSMUST00000109036
Sequence
GGTCAAGCTTGCAAGCTCCTTTCTGTAACTCAGCAGTCATGAGAGTTTCTGTGTGATGTGTTCTGCGTGACTCTACTGGGTGTTGTGAGAGGAGGTTAGT

CAAGCTCAGAACTCCAAACATG - UNI24596 - TGTCTTCGCTGGATGCTGTGAATTTAGCTCAAGCAAGCTCAGAACTTCACACATG - UNI759

6 - - UNI15567 - GATTTAGTCACCTATGATGACGTGCAGGTGAACTTCACTCAGGATGAGTGGGCTTTGCTGGATCCTTCTCAGAAGAGTCTCTA

CAAGGGTGTGATGCTAGAGACCTATAGGAATCTCACAGCTATAG - UNI25761 - GTTACATTTGGGAAGAACATACGATTGAAGACCATTTTCAAA

CTTCTCGAAGTCATGGAAGGTAATTTTACTCTGCAAGCTGAGGAGAAAATGCCTATGAAGAAAGTTTAACTTGTGGTACAAGTAGTAAAGAAAACCAATA

GGGTACAATAAGCACTGCTTTCAGTGATGGATGTTTACTGACTTTCATAAAAATCATATATGTTTATGGCAGATATGTAACTGTTGTTTGCAAGACATTC

CATTAGGTCAAAGTCAGAGAAATAATGGCTTAACACATATGTTACTGTTTAAATCAAGCCTAGTACAGCCATGCTATACAAGTGTGAGTGTCTTCAGTCT

TATATCGCTTAGCTATTGCAAAAGGAACACATAGTGATTAGGTGACAAGTATATGTCTAAAACCTAGTAATGAGCAAATAATCCATAGTATATCTGAGCT

CAATGATATACTTGTAATAACATTGCTAAATTTAGTGAGATGAACAGTTCATAAGATTCAAAAATGGTTTTGTGGAAAAACCTTAATCTCTGTACCACAT

CTCTGTGACAAAAAAAAGTCAGCTGTGAATGTAATGTGGAATTTTCACTTGTTATTCTTCTTTTGATGTGGATGTCATAGGTTACGATTGATACAAGCCT

TGTGATCACTGGGGCATTGAAAGAAGCCACATACCTTTCACTTTTCCAGAACAATTAGAGGATATGCAGTATAACATATTTTGAACAACATACTTAATGT

GCTATATAAGTTTATAAAAAATTTGTTTCCGAACATTGCTGGGAACATTTACCAACTCTAACTGCTGAAAATAGTAATGAGAATTAAGGCAGTAGAAATT

TTTTTTCTTTTGCATTTGTTCATATTCCAAATGTAGTATTACTCTCATGATAACAAAATTTGTGAATGCAATCATTGTGCAAACACTGTGAGTTCTTCCT

GTTTTTTTTCAAATATGTGAGTAACCTTTTATAGAAAAAGTATGTTATAAATGTGAGCCTGATAATCAATACTGTTCCCATTTCATATATCCTCGAAGAT

GTAAACAATTCATAATTTAGTAGAACTCCTTTGAATATAAACAAAGTAATATTATGTTAA
Translation
 - UNI24596 - M - UNI7596 - - UNI15567 - DLVTYDDVQVNFTQDEWALLDPSQKSLYKGVMLETYRNLTAIG - UNI25761 - GY

IWEEHTIEDHFQTSRSHGR

For any suggestions or comments, please send an email to unitrap@crg.es