Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000078901 (RP23-166A1.1)
Chromosomal location
Chr 2: 175100626 - 175112466 (+)
Description
ethanol induced 1  [Source:RefSeq peptide;Acc:NP_001028295]
RefSeq_peptide
NP_001028295.2 
UniGene
Mm.422667 Mm.444548 Mm.455970 Mm.459198 
Uniprot/SPTREMBL
A2ARS7 
Human Ortholog
not available
Omim not available
UniTrap UNI3681
Vector Insertion
Chr 2: 175100705 - 175108798
Public Clones XR0167 (sanger) RRI488 (baygenomics)
Private Clones OST66754 (lexicon)
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14212
Vector Insertion
Chr 2: 175108926 - 175109130
Public Clones CMHD-GT_84B9-3 (cmhd)
Private Clones OST62757 (lexicon)
Severity of mutation (?) Insertion after 68% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000109051
Sequence
AGTTTCTGTGTGATGTGTTCTGCGTGACTCTACTGGGTGTTGTGAGAGGAGGTTAGTCAAGCTCAGAACTCCAAACATG - UNI3681 - GATTTACT

CACCTATGATGACGTGCATGTGAACTTCACTCAGGAAGAGTGGGCTTTGCTGGATGCTTCTCAGAAGAGTCTCTACAAAGGTGTGATGGTAGAGACCTAT

AGGAATCTCACAGCTATAG - UNI14212 - GTTACAGTTGGGAAGAACATACAATTGAAGACCATTTCCAAACTTCTAGAAGTCATGGAAGGTAATT

TTCCTCTGCAAGCTGATGAGAAAATGCCTATGAAGAAAGTTTAACGTGTGCTACAAGTAGTAAAGAAAACCAATAGGGTACAATAAGCACTGCTTTCAAT

TATGGATGTTTACTGACTTTCATAAAATCATATATGTCTATGTCAAATACGTAATTATTGTTTGCAAGGCATTCCATTAGTTCAAAGACAGAGAAATAAT

GGCTTAACAGGTATGTTACTATTTAAATCAAGCTTAGTAGAGCCATGCTGTACAAGTGCGAGTGTCTTCAGTCTCATATCGCTTAGCTATTGCAAAAGGA

ACACACAGTGATTAGGTGACAAGTATATGTCTAAAACCTAGTAATAAGCAAATAATCCATAGTATATCTGAGCTCAATGATATACTTGTAATATCATTGC

TAAATTTAGTGAGATGGACAGTTCATAAGATTCAAAAATGGTTTGGTGATAAAACCTTAATCGCTATACTACATCTCTATGAGGAAAAAAGTCACGTGTG

TGAATGTAATATGGAACCTTTACACTTGTTATTCTCTTTTAATATGGTTGTCATACGTTACTATGGATACAGCCCTTGTGAGCATAGGGGTATTGAAAGA

TGCCACATACCTTTCACTTTTTCAGAACAACAAGAGGATATGCAGTATAACATACTTTGAGTGACATTCTAAATGTGCTGTAAGTTTATAAGTACTTAGT

TTCCCAACATTATTGGGGACATTTTCCAACTCAAACTGCTGAAAATCATAATTAGAATTAGGGTAGTAGAAATTATATTCTGTTTGCATTTGTTCATGTT

CCAAATGTAGTATTACTCTCATGATAACAAAATTTGTGAATGCAATCAGTGTGCAAAGACTTTGAGTTCTTCCTGTTTTTTTCAAATATGTGAATAACCT

TTTATACAAAAAGTATGCTATAAATGTGAGCCAGATAATCAATACTGTTCCCATTTCATGTATCCTCAAAGATGTAAAACAATCCATAACGAGGAGAACA

CCTTTGAATGCAAACAAAGGCATATTACATTAACATTAGATTGCTCTTTTGAATGAAGCCAATTTTTAAAAGAATTCATACAGATAAAAAGACTCATCAG

TATAATCAATGCGAGAACAATTTCACGTGTGCCAATTGTATTTGCAGGCATGAAAGAAGTTCTTCTGCAGAGCAACACTCTGAGTTTATTCAATGTGGTA

AAGCCTTTGCATATCAGTCATAGTCAAAGGCATGTAAGAATACACAATGGAGAGAAACACTGTGAGTGTAACCAATGTGGTAAAGACTTTGGAACAAGGA

GTGTCCTCCAAAGACTTAAACGAACACATACAGGAGAGAAACCCTATGAATGTAACCACTGTGGTAAAGCCTTTGCAGAAAGCAGTACTCTCCAAATCCA

TAAGCGAAAACATACAGGAGACGAACCATATGAATGTAACCACTGTGTTAAAGCCTTTGCAAAAATGAGTGAACTCCAAATACATAAACGAATACATACA

GGAGAGAAACCCTATGAATGTAAGCAATGTGGTAAAGCCTTTACACAAAGCAGTCATCTCGGAATCCATAAGCGAACACATACAGGAGAGAAACCCTATG

AATGTAAACAATGTGATAAAGCTTTTGTAAGAAGGGGAGAACTCCAAATCCATAAGTGAACACATACAGGAGAGAAACCCTATGAATGTAAGCAATGTGG

TAAAGCCTTTGCACAAAGCGGTACTCTCCAAATCCATAAGCGAACACATACAGGAGAGAAACCCTATGAATGTAAACAATGTGGTAAAGCCTTTGCACAA

AGTGGTACTCTCCAAGTACATGAGCGAACACATACAGGAGAGAAACCCTTTGAATGTAACCAATGTGGTAAAGCCTTTGTACAATGCATTGCTCTCCGAA

TACATGAACGAACACATACAGGAGAGAAACCCTATGAATGTAAACAATGTGGTAAAGCCTTTGCACATAGCAGTCATCTCCGAATACATAAGCAAACACA

TACAGGAGAGAAACCCTATGAATGTAAACAATGTGGTAAAGCCTTTGCACATAGCAGTACTCTCCAAATACATAAGCGAACACATACAGGAGAGAAACCA

TAAGAATGTAAACAATGTGGTAAAGCTTTTAAAAGAAGTGGTGACCTTCTAATACATAAGCGAACACATACATGAGAGAAACCCTGTGAATGTAAGAAAT

GTGGTAAAGTTTTTATAAGAAGTGTTGACCTTCAAATACATAAGTGAAGACATTAGGAGATAAACCCTATGAATGTAAACAATGTGGTAAAGCTTTGCAG

AAAGCAGTACTCTCCAGATACATAAGCGAACACATACAGGAGAGAGACCCTATGAATGTAACTAGTGTGGTAAAGCCTTTGCAGGAAGGAGTGACCTGCA

AAGACAAAAGATCATACAGAAGAGAAAGTCTATGAAGGCATCTAATGTTATAAAGTCTTTGCAGCAAGCATTGATCTCCACGTATATAAATGAACACATA

CCAGAGAGGAACCTTTTAAATGTAACCAACATGGTAAAGCTTTTTCAAAAACCAATAGTCTTTACATACATAAAAGAATATATACTTGAGAGAAATGGTT

CGACTTTAACCAATGTGGTTAAACTTTTTCAAAAGCAGTCATCAACAAAATCATAAAACAACACGTATAGGAGAGAGATTTTTGAATGTTAGCAATGTGC

TTTTACACCTTTTTTCACAAAACAGTGGCCTCAAAATATATAAGGAAACACGTACTGGAGAGAAAACCTATGAATATCAGCAATGTCCTGAAACCCTTCT

ACATCACAATCATCTTCAAATCCATAAAGAACATGTAGTGGAGAAAAATCCTCTGAATATCACTAATTAGGTAAAGCAGTTATAAAGAGTCATCTCCTAA

CACAAAAGTATACACACTGGATAGAAACCCTATGAATATAAGCAATGTGGTAAATGTTTTATAAGTCACAGTATTCTCTAAGTAAATAAAGGAAGACACA

CTTGAGAGAAACCCTATGAAAATTATTAAAGGTACAAAGCCTTGTACATTAAAATCTTCAAATCAATAAAAGAAGACATAGAGGTGAGAAACCCTATGTT

TGCAAGCCA
Translation
M - UNI3681 - DLLTYDDVHVNFTQEEWALLDASQKSLYKGVMVETYRNLTAIG - UNI14212 - GYSWEEHTIEDHFQTSRSHGR
Transcript ENSMUST00000098998
Sequence
GATTTACTCACCTATGATGACGTGCATGTGAACTTCACTCAGGAAGAGTGGGCTTTGCTGGATGCTTCTCAGAAGAGTCTCTACAAAGGTGTGATGGTAG

AGACCTATAGGAATCTCACAGCTATAG - UNI14212 - GTTACAGTTGGGAAGAACATACAATTGAAGACCATTTCCAAACTTCTAGAAGTCATGGA

AG AGTCTTCACAATGAAACAATCCATACTGCCAAGAAATTTAGGAATATAA
Translation
DLLTYDDVHVNFTQEEWALLDASQKSLYKGVMVETYRNLTAIG - UNI14212 - GYSWEEHTIEDHFQTSRSHGR RVFTMKQSILPRNLGI

For any suggestions or comments, please send an email to unitrap@crg.es