Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000078961 (AC102262.9)
Chromosomal location
Chr 15: 81516636 - 81523571 (-)
Description
not available
Human Ortholog
not available
Omim not available
UniTrap UNI30423
Vector Insertion
Chr 15: 81516833 - 81522537
Public Clones CMHD-GT_383H5-3 (cmhd) IST14528E4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000109562
Sequence
GCCTTCTCAGGCCTGGGAAAAGGGCTGCGGAGCTTGTACCTGCACAAGAATCAACTTCAGTCCCTGCCTGCCCCGCTGGGGCTCAGCGGGCTGGAGCTGG

TCGACCTCAGCGGTAATCCTTTCCACTGTGACTGCCAGCTGCTCCCGCTGCACAG GTGGCTCACTGGGCTGAACCTGCGGGTGGGTGCCACCTGTGCCA

CCCCTCCCAGTGTCCGTGGCCAGAAGGTGAAGGTTGCAGCTCCTGTCTTTGAAGCCTGCCCAGGCTGGACTGCCAGGAAGGCCAAGAGGACACCAACCTC

CAGAGGCAGTGCCAGGAGAACTCCCAGCCTCAGCCGACATTGAGGAACAGACAAG - UNI30423 - GTAGAGAAACAAAGAGACCACATCTGAGAGT

GGAGCAGCCTGCCCCTGACCGCTGACCCTACCCAGCCCACCGGCTCTTACTGTCATCAGGAACTGGTTCCGAGACCCCCAAAGCCTCAAGGTTGTCCTCC

AGTAAGGGTTTCTTGGAGCCCTGTCTGAGGGGCCGAGTCTTGGCTGATGGGATTCTTTTCCCTATG
Translation
AFSGLGKGLRSLYLHKNQLQSLPAPLGLSGLELVDLSGNPFHCDCQLLPLHR RWLTGLNLRVGATCATPPSVRGQKVKVAAPVFEACPGWTARKAKRTP

TSRGSARRTPSLSRH - UNI30423 - 

For any suggestions or comments, please send an email to unitrap@crg.es