Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000078974 (Sec61g)
Chromosomal location
Chr 11: 16400533 - 16408487 (-)
Description
SEC61, gamma subunit Gene [Source:MGI (curated);Acc:Sec61g-001]
RefSeq_peptide
NP_035473.2 NP_001103441.1 NP_001103442.1 
MGI
MGI:1202066 
Uniprot/SWISSPROT
P60060 
Uniprot/SPTREMBL
Q5SWJ8 
Human Ortholog
ENSG00000132432 (SEC61G)
Omim not available
UniTrap UNI21243
Vector Insertion
Chr 11: 16406476 - 16407982
Public Clones (sanger) IST11272C6 (tigm)
Private Clones OST337361 (lexicon) OST290114 (lexicon) OST236301 (lexicon) OST80537 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26033
Vector Insertion
Chr 11: 16404842 - 16406375
Public Clones not available
Private Clones OST144132 (lexicon)
Severity of mutation (?) Insertion after 46% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36930
Vector Insertion
Chr 11: 16401653 - 16404842
Public Clones (sanger) 5SD051H02 (ggtc) 3SD051H02 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 96% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000109641
Sequence
GGAAAGCTGGTCTAGGGTTCATGGCACAAAGGGGCCGCGGGATGGGAGGCCAGGGACACGGAGGGACCAGGGGAGGTGAAGAAACTGGAG - UNI2124

3 - ACAAACATGGATCAGGTAATGCAGTTTGTGGAGCCCAGCCGGCAGTTTGTAAAGGACTCAATTCGGCTGGTTAAAAGATGCACCAAACCCGACAGA

AAAG - UNI26033 - AATTCCAGAAGATTGCCATGGCTACAGCTATAGGATTTGCTATCATGGGATTCATTGGCTTCTTCGTGAAACTGATCCATAT

ACCCATTAATAACATTATTGT GGGTGGCTGAGTCCTTCTCATCATGGGACGAGTGAGCCAGAGCGGGGGAAAGGGCATGAAGTAAAGCGTTGCCTGAAT

GCTGTGTGGTGTTTTGTTTCTTCCTCCTTCCTATGAGGTTTTCTACTTCTCAATTAAAATAATTTCAAAATAAACACTT
Translation
 - UNI21243 - MDQVMQFVEPSRQFVKDSIRLVKRCTKPDRKE - UNI26033 - EFQKIAMATAIGFAIMGFIGFFVKLIHIPINNIIV VGG
Transcript ENSMUST00000109642
Sequence
CGGTTCCGTTGGGCTCGGTTCTCTCCTGAGCTACGTGTCTCTACGCTCTCAATCCGCCATCCAGTAA - UNI21243 - ACAAACATGGATCAGGTAA

TGCAGTTTGTGGAGCCCAGCCGGCAGTTTGTAAAGGACTCAATTCGGCTGGTTAAAAGATGCACCAAACCCGACAGAAAAG - UNI26033 - AATTC

CAGAAGATTGCCATGGCTACAGCTATAGGATTTGCTATCATGGGATTCATTGGCTTCTTCGTGAAACTGATCCATATACCCATTAATAACATTATTGT G

GGTGGCTGAGTCCTTCTCATCATGGGACGAGTGAGCCAGAGCGGGGGAAAGGGCATGAAGTAAAGCGTTGCCTGAATGCTGTGTGGTGTTTTGTTTCTTC

CTCCTTCCTATGAGGTTTTCTACTTCTCAATTAAAATAATTTCAAAATAAACACTTTTTCCATAACAGACATTTATCAAATTTTAGTAAAAGATGATACT

AGTTTTTTTTTTTTTATTCCCTTGAGGTTTTTTGGTTTGAAGGAAAAAATTACAACAATTGCTGAAACATTGTAAATTCAGATGCTTTTCTGCCTTAGAC

TGTTTGGACAGCTATAACTCGAAGCTGAGTAGTTTGTAGGGAGAGGATTCCCTTTTCACATCCTGAGAGCCATGAAAGCCAAGTGTAGCAGTGCCAGCAG

GTTCAGGGGATGCTGGGAAC
Translation
 - UNI21243 - MDQVMQFVEPSRQFVKDSIRLVKRCTKPDRKE - UNI26033 - EFQKIAMATAIGFAIMGFIGFFVKLIHIPINNIIV VGG
Transcript ENSMUST00000109643
Sequence
TATTTGCATGCGCAGCGGGGAGACTCATAGCTGTAGCGCAGACACTCACTCACTAACTAACTAGCGACACTTCGTGGATTTACGTTGAGGCTGCTGGAGA

GGCTGCTGGAGAGGCTGCGCCCGAGACCGGGAGGCGAACAATCGGGAACCAAGATCCCACACCGCCCGCCCGTTCAGCTGGAGAGACCCGAATCGCTCAG

GTCGGCCTCTGCTCGGGAAGCCGGGAGAAACACACGTAGCACTGCGCCGGCGTAGTGACGTCTCTGCGTGAAGAGCCAATTGAAAGGAGGAATGGGCGGG

CTGTGGGTTGCCAGCTTCCGGTTCCGTTGGGCTCGGTTCTCTCCTGAGCTACGTGTCTCTACGCTCTCAATCCGCCATCCA - UNI21243 - ACAAA

CATGGATCAGGTAATGCAGTTTGTGGAGCCCAGCCGGCAGTTTGTAAAGGACTCAATTCGGCTGGTTAAAAGATGCACCAAACCCGACAGAAAAG - UN

I26033 - AATTCCAGAAGATTGCCATGGCTACAGCTATAGGATTTGCTATCATGGGATTCATTGGCTTCTTCGTGAAACTGATCCATATACCCATTAA

TAACATTATTGT GGGTGGCTGAGTCCTTCTCATCATGGGACGAGTGAGCCAGAGCGGGGGAAAGGGCATGAAGTAAAGCGTTGCCTGAATGCTGTGTGG

TGTTTTGTTTCTTCCTCCTTCCTATGAGGTTTTCTACTTCTCAATTAAAATAATTTCAAAATAAACACTTTTTCCATAACAGACATTTATCAAATTTTAG

TAAAAGATGATACTAGTTTTTTTTTTTTTATTCCCTTGAGGTTTTTTGGTTTGAAGGAAAAAATTACAACAATTGCTGAAACATTGTAAATTCAGATGCT

TTTCTGCCTTAGACTGTTTGGACAGCTATAACTCGAAGCTGAGTAGTTTGTAGGGAGAGGATTCCCTTTTCACATCCTGAGAGCCATGAAAGCCAAGTGT

AGCAGTGCCAGCAGGTTCAGGGGATGCTGGGAACATGGTCTCAGGGCTTCAAAGAGTGGCCTAGGATGCTAAAGGACAAGGAGATGTACGAAGAGGCTTT

AATAGTGGCCATAATCCCTCAGGTAAGGAGGACCCTGTGTGACCCAATCACCCAAATACCCGCTCTCATAGCTGGAGATTAAATATCCCTGGAACGTTAG

AACAACACATTAAAATCATAGGTAGCATTTTCTGAGATGTTCTGCTGTAGTAGAAACAGTGGGTAAATGATGGGAAAGATCGTGAAACCATTACTTTTGA

GGTAGGATAGTGATTTTGTCCACATTGCACTTAAATTGTAGACAGATAATGCAGCAGTTGAGGTGATATTTGAAGCAGCTTTCTGAAAATCTGGTTAAAG

TCTGGAAGTGAACGTCTTTCCCCACAAAGTGCTAACCAGTCACACCTCCGTGAATATCACCGTTCTGAGTTTATTGATTCTGAATTTGTTTTTTGTCTAC

TCATCAGCACACATGGTGACAGAACTTTAAGTCTGTGTTTTGTATTGCTAGTGTTATGGCACGTATTGATGAACTTACTAAAAACTTAAGAGTTCTGAAC

ATTGGGAACAGTGTTCAGGTTCCAGCATCCTGCAAAGGACTTGTTGCCAACTCATACTTTGATTGTGCCTGAGAGAGCAGGAAATGGACAGCTAGCAGCT

GCAAGCTGCTTAGTAATTGTCTGGGCCTACCACTCAACTCTGTCGCACTGGGGATACATCCAAGTATAGGAAATAATCCGATTTTCTCTTTTTGGATCCT

TCATTTTTTTTTTAAGTCATTGTGATTATAACTGATAGTATGATTTTGAAATGTTTCCAGTGTTTGAATCGTGAATGAAGCGTCGTCCTTG
Translation
 - UNI21243 - MDQVMQFVEPSRQFVKDSIRLVKRCTKPDRKE - UNI26033 - EFQKIAMATAIGFAIMGFIGFFVKLIHIPINNIIV VGG

For any suggestions or comments, please send an email to unitrap@crg.es