Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000078995 (Zfp456)
Chromosomal location
Chr 13: 67464520 - 67476699 (-)
Description
zinc finger protein 456 Gene [Source:MGI Symbol;Acc:MGI:3040694]
RefSeq_dna
NM_001001186 
RefSeq_peptide
NP_001001186.3 
UniGene
Mm.398872 
MGI
MGI:3040694 
Uniprot/SPTREMBL
B2RUK9 Q7M6X8 
Human Ortholog
not available
Omim not available
UniTrap UNI21818
Vector Insertion
Chr 13: 67473209 - 67473686
Public Clones not available
Private Clones OST316867 (lexicon)
Severity of mutation (?) Insertion after 9% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000057070
Sequence
GTACTTGTGCCTCTTCCTCAAAGTTGGGCGGAAATGATATTCGGCTATCTATTCCAGTTGTCTCTGACAAGAAG GAAATGTTGTCCTTCTGGGATGTGG

CCATTGATTTCTCTCCAGAAGAGTGGGATTGCCTGGAGCCTGCTCAGTGGGATCTGTACAGGAATGTGATGCTGGAGAATTTCAGCCACCTTGTGTTCCT

GG - UNI21818 - GTCTTGCTGTCTCTAAGCCATTCCTGGTGACATTTCTGGAGCAAAGACAAGGGCCTTGGGATATGAAGAGACAAGGAATGGCCA

CTGTGTACCCAG GAATAAAACCCAATGATCCTAACAATTTCAGCAAACTGACTAATTGTAAATCACTCCTTATTACACAAAGAAGAAATCATATAGGGG

AGAAACCCTACAAGTGTGGAGAATGTGGTAAGGCCCTTAGTTCTCATAAAACACTTTCTATACATCAGAGACTTCACACTGGAGACAAACCTTACAAGTG

TGAAGAGTGTCATAAGGCCTTCAGTACTCGCTCATCACTTTTTATATACATGAAAAATCATACTGATGAAAAAATCTACAAGTGTGAAGACTGTGGCAGA

ACATTTTACTATCTTTCAATGCTGAAGCAACATCAGAGAATTCATTCTGGAGAGAAACCCTACAAGTGTGAAGAATGTGGGAAATGCTTTGGCTTTCCCT

CATTCCTTAAGCAACATCAAAACATTCATTGTAGAAAAAATGCCTACACATATGAAGATTGTGTGAAAAGACTTTCCCCTCCTCTACCTCTTCAAGACAA

TGAGCAAATCCATACTGAAGAGAAACCTTACAAGTGTGGAGAATGTTATAAAGCCTTTTCTTATCACTCAGCCTTTAGGATACACAAGACAGTTCATACT

GGAGAGAATCCTTACAAGTGTGAAGAGTGTGGCAAATGTTTTTCCTCATCTTCCTACCTTAAAAGACATCAAACCCTTCACTCTGAAGACAAACCCTACA

AGTGTGAAGACTGTGGCAGATGTTTCTGCTCATCTTCATCTCTCAGGCGACATCAAAAATTCCATTCTGAAGGCAATCCCTATAAGTGTGAAAAATGTGA

CAAAAGGTTTTCATGCTCTGCAAGTCTTCAGGAGCATCAAACAATTCATACTGGAGAGAAACCATACACTTGTGAAAATTGTCACAAAGCCTTTCGTTAT

CGCTCATCCCTTAGGAAACATAAGACAGTTCATACCAGAGAGAAATCCTACAATTGCAAGAAGTGTCCTAGGGCCTTTTCCTCATACTCATGCTTTGTAC

GACATCAAGCTATTCACTCTGAAGATAATCCACACAAGTGTGTGGAATGTGGCAAAGCCTTTGTTAATGTTTATAGCCTGACTCGACACATGACAGTTCA

TGCTGGAGAGAAATCCTACAAAGGTCTTAAAACACTTATACTTCTTCAGTCCTTAAAAGACATCAAATAATTCTTACCGAATAAAACTCTTTGACTGTGT

GGAGTGTGGTAAAAAACGATTCCTAATCCTTCAAACCGTATCCAACTCAAATCAATCCATAGGGTAGACTATTAAGTGAATTAGTTTGGAATGTCAACAC

CACCATCTTACTCCCAGCAGCACAAATGTTGAGAATGTCATCAGAGAACTGTAGAGACTTCTCTTTACTATAACCTCCCAACCAATGTGTTCTATAGTGT

GCTTGAATATGGCATGGGTTGTTGCATTTCTTTCTTCTGTACCTACAGGCATAAAGCAGAACTGTTATTATTTCATAATGTGCGCCTGAGATCTGGGCCA

TTTTATAGTTACTGTTGTTTTCCTCAGTGGGGTCACGCAAGCTCCCCAAATAATGTTTCTCCTGGGCATGTAAAAAGCTTGATAAACTCAGATGTCTCAC

TTTTTGTAAAATTATCTGCATTGGTTCTAATCTAGGTTGAATAGGTGTTAGTGTTTCTCTTTCCAGGAAATTCTAACAGAATGCACTGAAGTCATATTTA

GTTCCAGAATGAAGCATCTTTATTTCCTTTGATTACAGAGCAATGTTTCTCACCTTATTCCAACTTTCATGTCATAGAAACTTGACAGCAAATTGAAACA

TGGACCCAAGCCACATGCACTTACTCAGTAGTAGGGATGCATTTGATTGGTGCATATGTGATGTCAGTCATGAAATATAGTGTAGTTCTTATTTTATTAT

TGATAGAGATCCTAAAGAGTCATATCATTCTTGAGTTTATTAATTTGGGTAAACAATTATATTATGGGCAATTAAAACCTAAAAGTTAACAATTAATTTT

TAAGTGACTAAATGTCTCTAGTATACCTAAAATTGTAGTTTTATTCATGCTAAGTACAAGTGAAATTTATTTATGGAGATAAGTTAGGGATGGAGAGGCC

AATTTATATCTCTCAATCTTTAGTCTTCTGTCTACACTATGGAAGTACATCTTAAAACACATACCTCAATACAAGATTAAAATTAACTTAGTGTATTTAA

TATACCATAAAATTTAAAATCAACTGTAATTATATTTTTAAAAATTTTGGTCTGAAAAATAGAGTATTGGAACTAAAGGCGTTAAATCTACAATATCCTT

AGACGGCAGGACAACCCCAGGCTCAAGAGTACCACTCCTCTGGGACAGGAAATAGACCCTATCAGAGTAAATTGCATGTGAGCCACATACCATAACATGC

TAAGGATGTAAGGAAAAAGGCTTTGTTCAAATCTGGTGCTCTTGTCTGTTTTGCTCCATCGGATCTTACAACTGGGCTCTGATGAATTAACTGGTTGTTA

ATCTTTTTCAAATGTTAGATTGCCTTAAGAAAAATGAGTCCAAAGGCCCAGTTCCTGCCCCTTCATAAAATTCAAGGATTCGAAAAGAACTAATAGAACT

GGGGAATAAGGTGACTTAGGCCAGGCCAGGTTATCCTGACACTGTACCCCATACCCTCTGGAGCCTCCTCAGGGAGGCTCTGAAAAAGAAAATTGTCTTT

GCTGAGACAAGACTTATATGTATACAAAGGATTCCTTCTAAAAAACTGTCCATTGTGCGGGGGTACAGGGAAAAACCAAACAACAACAAAAAATCAACCA

AACAAAACACAACCCTTTGTTATACATCTCATGTGATGTGAGTGCAGCCTTTTGACCTTTAAAACTCTACCCCCACTCCCTTCCCTATTAAGATCCTTTC

TGAGTGGAAGCCCAAGCTTTCTCACGAATACCCTTATTGGCTTATTAATAAGGAAAAGTTGTAACTCTCACATGGGCTATTTCATTTGCCAGTTCTGAAG

TCAAGATAGAATTCTCATTTGATGAATAGTGGCTGTTCATTTATACCCTCAGCTGGTACCAACTGAGAAGCTTGCTGTCTGCTGGCTACCTTTCATATTG

GTGGCACAATCTAGGTATGCTACCATCGAAGTACCTGAATAAACAGTCTTACCCAGCAGTGAACACAGGGAGTAGAATAAATGGTCAGGCAAATTGAAGT

GCCAGTGGAGCAATAGGGACAGCAAAGTTATGGGAGTGACCAATTATTTTCTGGTTGAATTTAAAGCTCATTCCATGGACAGTAACTAATAACTGGTGAT

GTTAATCAGATGATAAAAAGGAGTATTGGTGAAGGTGTAGCCTCATTGGTAGTTGAAAGCCCAGGATTGAAGAGGTCATGCAAAAGAGTTGATGCATGTC

ACCATGAGGAGAGCCTATGAGAGGTGATTGGTGAAATTACAGCCTAGTTGCAATGGAAAACCCCAGTGCATTGAAGATGCCAGTACCATAGGATAATCTC

CAACAAGTGAAGTACAAATGGAGTGGAACCAGCCAGAGCTTAAAGGGCTACAGAGCACAGAGCTGGAGAATTGAAACTATTCCTTTGGAGGAGTCCTGAT

TGTGGATCCCAAATGTTGTAGACTTTGAACTTTGCTTTTAAACACTGTTGAGATGGTGATAGACTGTGGAGAGTTTTCAAGATGGACAAAATGCATTCTC

CATTGTGTTATAATCAGAGGCTTATGGGCACCAGGACCTGAAATGTGATATTTTGTAAACGTTTTTTTCTCCCATAAACTCATATCTTTGAATGC
Translation
 MLSFWDVAIDFSPEEWDCLEPAQWDLYRNVMLENFSHLVFLG - UNI21818 - GLAVSKPFLVTFLEQRQGPWDMKRQGMATVYPG GIKPNDPNN

FSKLTNCKSLLITQRRNHIGEKPYKCGECGKALSSHKTLSIHQRLHTGDKPYKCEECHKAFSTRSSLFIYMKNHTDEKIYKCEDCGRTFYYLSMLKQHQR

IHSGEKPYKCEECGKCFGFPSFLKQHQNIHCRKNAYTYEDCVKRLSPPLPLQDNEQIHTEEKPYKCGECYKAFSYHSAFRIHKTVHTGENPYKCEECGKC

FSSSSYLKRHQTLHSEDKPYKCEDCGRCFCSSSSLRRHQKFHSEGNPYKCEKCDKRFSCSASLQEHQTIHTGEKPYTCENCHKAFRYRSSLRKHKTVHTR

EKSYNCKKCPRAFSSYSCFVRHQAIHSEDNPHKCVECGKAFVNVYSLTRHMTVHAGEKSYKGLKTLILLQSLKDIK

For any suggestions or comments, please send an email to unitrap@crg.es