Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000079009 (EG245174)
Chromosomal location
Chr 2: 150007491 - 150019015 (+)
Description
predicted gene, EG245174 Gene [Source:MGI Symbol;Acc:MGI:3644476]
MGI
MGI:3644476 
Uniprot/SPTREMBL
A2ANU6 
Human Ortholog
not available
Omim not available
UniTrap UNI4658
Vector Insertion
Chr 2: 150007607 - 150016221
Public Clones AM0117 (sanger) AN0407 (sanger) (ggtc)
Private Clones OST191400 (lexicon) OST108633 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23323
Vector Insertion
Chr 2: 150016128 - 150016256
Public Clones not available
Private Clones OST264578 (lexicon) OST169198 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24322
Vector Insertion
Chr 2: 150016256 - 150016454
Public Clones not available
Private Clones OST224824 (lexicon) OST220339 (lexicon) OST189167 (lexicon)
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24522
Vector Insertion
Chr 2: 150016516 - 150017591
Public Clones not available
Private Clones OST216711 (lexicon)
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000109929
Sequence
ATGCTGGAGACCTACAGGAATCTCGCTGCTATAG - UNI23323 - - UNI24322 - GCTATGTTTGGGAAGACCATAATACGGAAGAGCATCTTC

ATATTTCTAGAAGATATGGAAG - UNI24522 - GCATGAAAGAAGTCATACTGAACAGCTGCTCTCTGAGTTTATCCAATGTGATAAAGCCTTTGCA

TTTCAGAGTCATAACCAAAGACAAGAAAGAATTCATACTGCAGAGACACCCTATGAATGTAACCAATGTGGTAAATCCTTTGCAAGAAAGAGTCATCTCC

TAAGACATAAAAGAACACATACTGGAGAGAAACCCTTTCAATGTTACCAATGTGGTAAAACTCTTGCTCGAAATACTCATCTCCTACAACATAAAAAAGT

ACACACTGGAGAGAAACCCTATGAATGTAAGCATTGTGACAAAGCCTCTGTATGTCATATTGGTCTCCTGTATCATAAAAGAACACATGCTGGACAGAGA

CCATATGAATGGAATGAATGTGGTAAATCCATTGTATATCACAGTTGTATTAAACAATGTAAAAGAAGACATACTGGAGAAAAACCCTTTGAATGTAACC

AATGTGGTAAATCCTTTGCAAGAAAGAGTAATCTCCTAAGACATAAAAGAATACATACTGGTGAGAAACCTTATAAGTGTGACCAGTGTGGTAAAGATTT

TGCAAGTCCCAGTTCTCTTAAATGCCATAAAAGAGTTCATACAGGAGAGAATCCTTATGAATGTAAACAGTGTGGTAAAGCCTTTGCACGTTTAAGTATT

CTCCGAACACATAAAAGAACACATACTGGAGAAAAACCCTTTGAATGTAACGAATGTGGTAAATCCTTTGCAAGAAAGAGTCATCTCCTAAGACATAAAA

GAATACATACTGGTGAGAAACCTTATAAGTGTGACCAGTGTGGTAAAGATTTAGCATGTCCCAATTCTCTTCAATACCATAAAAGAGTTCATACAGGAGA

GAAATCTTATGAATGTAAACAATGTGGTAAAGCCTTTGCATTTTCAACTAGTCTCCGAATACATAAAAGAACACATACAGGAGAGAAACCCTATGAATGC

AATCAATGTGGTAAAGCCTTTTCGTCTCCAAGTGGATTCCTGTATCATAAACAAACACATACTGGAGAGAGACCATATGAATGCAATGAATGTGGTAAAT

CCTTCATACATCGCAGTAATTTTCAAATGCATAAAAGAACACATACTGGAGAGAAACCCTTTGAATGTGACCAATGTGGTAAAAGCTTTGCACAAAACAC

TTATCTTTTACAACATAAAAGAGTACACACTGGAGAAAAACCCTATGAATGTAAGCATTGTGGCAAAGCCTTTGCATATTCTAATAATCTCCGAGTGCAT

ATTAGAACACATACTAAGTATTTAGTATGGTAA
Translation
MLETYRNLAAIG - UNI23323 - - UNI24322 - GYVWEDHNTEEHLHISRRYGR - UNI24522 - RHERSHTEQLLSEFIQCDKAFAFQSH

NQRQERIHTAETPYECNQCGKSFARKSHLLRHKRTHTGEKPFQCYQCGKTLARNTHLLQHKKVHTGEKPYECKHCDKASVCHIGLLYHKRTHAGQRPYEW

NECGKSIVYHSCIKQCKRRHTGEKPFECNQCGKSFARKSNLLRHKRIHTGEKPYKCDQCGKDFASPSSLKCHKRVHTGENPYECKQCGKAFARLSILRTH

KRTHTGEKPFECNECGKSFARKSHLLRHKRIHTGEKPYKCDQCGKDLACPNSLQYHKRVHTGEKSYECKQCGKAFAFSTSLRIHKRTHTGEKPYECNQCG

KAFSSPSGFLYHKQTHTGERPYECNECGKSFIHRSNFQMHKRTHTGEKPFECDQCGKSFAQNTYLLQHKRVHTGEKPYECKHCGKAFAYSNNLRVHIRTH

TKYLVW
Transcript ENSMUST00000109926
Sequence
GCCTGTAAGTTCCTGTCTGAATCTGAGCCGGAAAGAAGGTTTCTCTGCGGTGTGTCCTGAGTGCCTCTGCTGGGTGCTCTGAGGGAGCTCTGAAAAGCTT

AAAATTTCCGGACATG - UNI4658 - - UNI23323 - GGTAGAGTGACCTATGATGATGTGCATGTGAACTTCACTCGGGAAGAGTGGGCTTTGC

TGGATTCTTCTCAGAAGAATCTCTACAAAGAAGTGATGCTGGAGACCTACAGGAATCTCGCTGCTATAG - UNI23323 - - UNI24322 - GCTA

TGTTTGGGAAGACCATAATACGGAAGAGCATCTTCATATTTCTAGAAGATATGGAAG - UNI24522 - GCATGAAAGAAGTCATACTGAACAGCTGC

TCTCTGAGTTTATCCAATGTGATAAAGCCTTTGCATTTCAGAGTCATAACCAAAGACAAGAAAGAATTCATACTGCAGAGACACCCTATGAATGTAACCA

ATGTGGTAAATCCTTTGCAAGAAAGAGTCATCTCCTAAGACATAAAAGAACACATACTGGAGAGAAACCCTTTCAATGTTACCAATGTGGTAAAACTCTT

GCTCGAAATACTCATCTCCTACAACATAAAAAAGTACACACTGGAGAGAAACCCTATGAATGTAAGCATTGTGACAAAGCCTCTGTATGTCATATTGGTC

TCCTGTATCATAAAAGAACACATGCTGGACAGAGACCATATGAATGGAATGAATGTGGTAAATCCATTGTATATCACAGTTGTATTAAACAATGTAAAAG

AAGACATACTGGAGAAAAACCCTTTGAATGTAACCAATGTGGTAAATCCTTTGCAAGAAAGAGTAATCTCCTAAGACATAAAAGAATACATACTGGTGAG

AAACCTTATAAGTGTGACCAGTGTGGTAAAGATTTTGCAAGTCCCAGTTCTCTTAAATGCCATAAAAGAGTTCATACAGGAGAGAATCCTTATGAATGTA

AACAGTGTGGTAAAGCCTTTGCACGTTTAAGTATTCTCCGAACACATAAAAGAACACATACTGGAGAAAAACCCTTTGAATGTAACGAATGTGGTAAATC

CTTTGCAAGAAAGAGTCATCTCCTAAGACATAAAAGAATACATACTGGTGAGAAACCTTATAAGTGTGACCAGTGTGGTAAAGATTTAGCATGTCCCAAT

TCTCTTCAATACCATAAAAGAGTTCATACAGGAGAGAAATCTTATGAATGTAAACAATGTGGTAAAGCCTTTGCATTTTCAACTAGTCTCCGAATACATA

AAAGAACACATACAGGAGAGAAACCCTATGAATGCAATCAATGTGGTAAAGCCTTTTCGTCTCCAAGTGGATTCCTGTATCATAAACAAACACATACTGG

AGAGAGACCATATGAATGCAATGAATGTGGTAAATCCTTCATACATCGCAGTAATTTTCAAATGCATAAAAGAACACATACTGGAGAGAAACCCTTTGAA

TGTGACCAATGTGGTAAAAGCTTTGCACAAAACACTTATCTTTTACAACATAAAAGAGTACACACTGGAGAAAAACCCTATGAATGTAAGCATTGTGGCA

AAGCCTTTGCATATTCTAATAATCTCCGAGTGCATATTAGAACACATACTAAGTATTTAGTATGGTAAAGCTTTTTCAAATGTCACAAGTTTTCATAATC

ACGAAAGAGAAACCCTATGAGTGTATTCAGTATGTTTAAACCTTTGCACATTTCTATAATCTTCATCATGAACGTATTCATAGAATTCAGAACGT
Translation
 - UNI4658 - - UNI23323 - MLETYRNLAAIG - UNI23323 - - UNI24322 - GYVWEDHNTEEHLHISRRYGR - UNI24522 - 

RHERSHTEQLLSEFIQCDKAFAFQSHNQRQERIHTAETPYECNQCGKSFARKSHLLRHKRTHTGEKPFQCYQCGKTLARNTHLLQHKKVHTGEKPYECKH

CDKASVCHIGLLYHKRTHAGQRPYEWNECGKSIVYHSCIKQCKRRHTGEKPFECNQCGKSFARKSNLLRHKRIHTGEKPYKCDQCGKDFASPSSLKCHKR

VHTGENPYECKQCGKAFARLSILRTHKRTHTGEKPFECNECGKSFARKSHLLRHKRIHTGEKPYKCDQCGKDLACPNSLQYHKRVHTGEKSYECKQCGKA

FAFSTSLRIHKRTHTGEKPYECNQCGKAFSSPSGFLYHKQTHTGERPYECNECGKSFIHRSNFQMHKRTHTGEKPFECDQCGKSFAQNTYLLQHKRVHTG

EKPYECKHCGKAFAYSNNLRVHIRTHTKYLVW

For any suggestions or comments, please send an email to unitrap@crg.es