Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000079103 (Tgm7)
Chromosomal location
Chr 2: 120919301 - 120935531 (-)
Description
transglutaminase 7 Gene [Source:MGI (curated);Acc:Tgm7-001]
MGI
MGI:2151164 
Uniprot/SPTREMBL
A2ART8 
Human Ortholog
ENSG00000159495 (TGM7)
Omim not available
UniTrap UNI33334
Vector Insertion
Chr 2: 120926694 - 120929741
Public Clones IST10343D10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 31% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13478
Vector Insertion
Chr 2: 120919874 - 120921590
Public Clones CMHD-GT_277G10-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 84% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000110676
Sequence
ATGATTGACAGCAACTCTCTCCAAGTCTCGATTTTCTCACCGGCTAGTGCGGTCATTGGCCACTACACCCTGAAGCTAGAGATCTCTCAGGGCCAGGGTC

CTGGTGTGACTTACCCACTGGGGAATTTCATCTTGCTTTTTAACCCATGGAGTACAG AGGATGATGTCTACCTGCCAAGTGAAACACTACTGCGGGAGT

ATATCATGAGTGACTACGGCTTTATCTACAAGGGTCAAACAAATTCCATTACCTCCAGGCCTTGGAACTATGGGCAG TTTGAAGAGGACATCGTCGATA

TCTGCTTTGAGATCCTGAACAAGAGCCTCTATTTTCTAAAGAACCCATCCAAAGACCACTCTCAGAGAAACAACGTGGTGTATGTGTGCAGGGTGGTAAG

CGCCATG - UNI33334 - ATCAACAGCAATGACGACAGTGGTGTGCTTCAGGGGAACTGGGGAGAGGATTACTCCCAGGGCACCAGCCCTCTGGAAT

GGAACGGCAGCGTGGCCATCTTGCGGCAGTGGTCGGCCAAGGGCGGGCAGCCTGTGAAATATGGACAGTGTTGGGTCTTTGCTTCTGTTATGTGCACGG 

- UNI33334 - TAATGAGATGCTTAGGTGTTCCAACCCGAGTCGTTTCCAATTTCCATTCTGCACACAACACAGATGGAAACTTGACCATCGACACCT

ACTATGATCGAACCGCAGAAATGCTGACGGCTCAGAGGCCAGACAAAATCTG - UNI33334 - GAACTTCCACGTCTGGAATGAGTGCTGGATGATC

AGGAAAGACCTTCCACCAGGGTACAACGGCTGGCAGGTTCTGGACCCCACCCCCCAGCAAACCAGCAGTG GGTTGTTCTGCTGTGGCCCTGCCTCTGTG

AAAGCCATCAAGGAAGGGGACGTCCAGCTGCCCTATGATACCCCTTTTGTGTATGCAGAAGTGAACGCTGATGAGGTCGTTTGGCTTTTTGAGGGTGGCC

AGGTCCAGGAGATCCTGGCCCATAACACCAGTTACATTGGGAAAGCAATTAGCACCAAGATGGTAGGGTCAGATGAGCGCCTGGACATCACCAGTTCCTA

CAAGTATCCAGAAG GATCCTCTGAGGAGCGGTCTGCATTCATTAAGGCTTCCTGGAAATTGCTGGAACCGAGAAGGAACGCTTCATCTCTCCTGGATCT

CCTAGGGTCTGAGAACTTAAAGGCTAAGCCTGTGAGGCTGCAACTCCACCTGGTTAGGGCACCCATGTGGGGCCAGGACCTGCCGCTCATGCTATATGTC

CAGAGGGTGCCAGTCAGAGACCATGTTCAGGGCTCTGTCGGACTGACGGTGCGCTTTTGTGCACAGGCCCTCCTGCATGGGGGTGGAACTCGGAAACCGT

TCTGGAGACACATAGTACACTTGAATGTGGATTTTGAGAAGG AGCTACAGTGGCCGTTCCTGCTGCCCTACAGCAGTTACAGGGACAAGCTGACAGATG

AAAGGCTGATCCGTGTGGCTGGCATCGCTGAGGTTGAAGAGACAGGGCAGTTCATTCTGGTCCTAAAAGATTTCTCTCTGGAGCCTCCCCACTTGTCTAT

TGAG - UNI13478 - GTGTTTGAAAGGGCTGAGGTGGGCAAGGCTCTGGATATCCACATCACCCTCACCAACACCCTGATGGTGCCTCTGAATAACT

GCACCATGGTTCTGGAGGGGAGTGGCCTCATCAATGGGCAGATGACAAAAGA CCTTGGGACTCTGATGGCCGGACACACTATCCGAATTCATCTGGAGC

TCTACCCCATCAAAGCTGGGCCCCACCAGCTACAAGTCCTCATCAGCAGCAGTGAGGTCAAGGAGATCAAAGGCTACAAGGACATCTTGGTTGCTGCAGC

TCCAGCCTCCTGA
Translation
MIDSNSLQVSIFSPASAVIGHYTLKLEISQGQGPGVTYPLGNFILLFNPWSTE EDDVYLPSETLLREYIMSDYGFIYKGQTNSITSRPWNYGQ FEEDI

VDICFEILNKSLYFLKNPSKDHSQRNNVVYVCRVVSAM - UNI33334 - INSNDDSGVLQGNWGEDYSQGTSPLEWNGSVAILRQWSAKGGQPVKYG

QCWVFASVMCTV - UNI33334 - VMRCLGVPTRVVSNFHSAHNTDGNLTIDTYYDRTAEMLTAQRPDKIW - UNI33334 - WNFHVWNECWMIR

KDLPPGYNGWQVLDPTPQQTSSG GLFCCGPASVKAIKEGDVQLPYDTPFVYAEVNADEVVWLFEGGQVQEILAHNTSYIGKAISTKMVGSDERLDITSS

YKYPEG GSSEERSAFIKASWKLLEPRRNASSLLDLLGSENLKAKPVRLQLHLVRAPMWGQDLPLMLYVQRVPVRDHVQGSVGLTVRFCAQALLHGGGTR

KPFWRHIVHLNVDFEKE ELQWPFLLPYSSYRDKLTDERLIRVAGIAEVEETGQFILVLKDFSLEPPHLSIE - UNI13478 - VFERAEVGKALDIH

ITLTNTLMVPLNNCTMVLEGSGLINGQMTKD DLGTLMAGHTIRIHLELYPIKAGPHQLQVLISSSEVKEIKGYKDILVAAAPAS
Transcript ENSMUST00000110675
Sequence
CAAGTGGCAGCCTTGGAGCTCAGGTCTGTGGAACTGCAGATCCCCAGGAACAACAAGGACCACCACACTGAGGATTTGGGCTTGTCGAAGCTCATCCTGC

GCCGTGGCCAGATCTTCATCTTAACGATAGTCTTCAGTCGACCCTTCCAGCCCCAAAAGGATCATCTCACCTTTGTGGCTGAGACAG GACCAGAGCCCA

CAGAGCTTCTGGGGACCCGAGCCACTTTCTTCCTCGCCCAGACCCGACCTGAGAACGTCTGGAGTGCTTCTGACTTCATGATTGACAGCAACTCTCTCCA

AGTCTCGATTTTCTCACCGGCTAGTGCGGTCATTGGCCACTACACCCTGAAGCTAGAGATCTCTCAGGGCCAGGGTCCTGGTGTGACTTACCCACTGGGG

AATTTCATCTTGCTTTTTAACCCATGGAGTACAG AGGATGATGTCTACCTGCCAAGTGAAACACTACTGCGGGAGTATATCATGAGTGACTACGGCTTT

ATCTACAAGGGTCAAACAAATTCCATTACCTCCAGGCCTTGGAACTATGGGCAG TTTGAAGAGGACATCGTCGATATCTGCTTTGAGATCCTGAACAAG

AGCCTCTATTTTCTAAAGAACCCATCCAAAGACCACTCTCAGAGAAACAACGTGGTGTATGTGTGCAGGGTGGTAAGCGCCATG - UNI33334 - AT

CAACAGCAATGACGACAGTGGTGTGCTTCAGGGGAACTGGGGAGAGGATTACTCCCAGGGCACCAGCCCTCTGGAATGGAACGGCAGCGTGGCCATCTTG

CGGCAGTGGTCGGCCAAGGGCGGGCAGCCTGTGAAATATGGACAGTGTTGGGTCTTTGCTTCTGTTATGTGCACGG - UNI33334 - TAATGAGATG

CTTAGGTGTTCCAACCCGAGTCGTTTCCAATTTCCATTCTGCACACAACACAGATGGAAACTTGACCATCGACACCTACTATGATCGAACCGCAGAAATG

CTGACGGCTCAGAGGCCAGACAAAATCTG - UNI33334 - GAACTTCCACGTCTGGAATGAGTGCTGGATGATCAGGAAAGACCTTCCACCAGGGTA

CAACGGCTGGCAGGTTCTGGACCCCACCCCCCAGCAAACCAGCAGTG GGTTGTTCTGCTGTGGCCCTGCCTCTGTGAAAGCCATCAAGGAAGGGGACGT

CCAGCTGCCCTATGATACCCCTTTTGTGTATGCAGAAGTGAACGCTGATGAGGTCGTTTGGCTTTTTGAGGGTGGCCAGGTCCAGGAGATCCTGGCCCAT

AACACCAGTTACATTGGGAAAGCAATTAGCACCAAGATGGTAGGGTCAGATGAGCGCCTGGACATCACCAGTTCCTACAAGTATCCAGAAG GATCCTCT

GAGGAGCGGTCTGCATTCATTAAGGCTTCCTGGAAATTGCTGGAACCGAGAAGGAACGCTTCATCTCTCCTGGATCTCCTAGGGTCTGAGAACTTAAAGG

CTAAGCCTGTGAGGCTGCAACTCCACCTGGTTAGGGCACCCATGTGGGGCCAGGACCTGCCGCTCATGCTATATGTCCAGAGGGTGCCAGTCAGAGACCA

TGTTCAGGGCTCTGTCGGACTGACGGTGCGCTTTTGTGCACAGGCCCTCCTGCATGGGGGTGGAACTCGGAAACCGTTCTGGAGACACATAGTACACTTG

AATGTGGATTTTGAGAAGG AGCTACAGTGGCCGTTCCTGCTGCCCTACAGCAGTTACAGGGACAAGCTGACAGATGAAAGGCTGATCCGTGTGGCTGGC

ATCGCTGAGGTTGAAGAGACAGGGCAGTTCATTCTGGTCCTAAAAGATTTCTCTCTGGAGCCTCCCCACTTGTCTATTGAG - UNI13478 - GTGTT

TGAAAGGGCTGAGGTGGGCAAGGCTCTGGATATCCACATCACCCTCACCAACACCCTGATGGTGCCTCTGAATAACTGCACCATGGTTCTGGAGGGGAGT

GGCCTCATCAATGGGCAGATGACAAAAGA CCTTGGGACTCTGATGGCCGGACACACTATCCGAATTCATCTGGAGCTCTACCCCATCAAAGCTGGGCCC

CACCAGCTACAAGTCCTCATCAGCAGCAGTGAGGTCAAGGAGATCAAAGGCTACAAGGACATCTTGGTTGCTGCAGCTCCAGCCTCCTGAGGCCTGCCTT

CCTACTGCCCTTCC
Translation
 MIDSNSLQVSIFSPASAVIGHYTLKLEISQGQGPGVTYPLGNFILLFNPWSTE EDDVYLPSETLLREYIMSDYGFIYKGQTNSITSRPWNYGQ FEED

IVDICFEILNKSLYFLKNPSKDHSQRNNVVYVCRVVSAM - UNI33334 - INSNDDSGVLQGNWGEDYSQGTSPLEWNGSVAILRQWSAKGGQPVKY

GQCWVFASVMCTV - UNI33334 - VMRCLGVPTRVVSNFHSAHNTDGNLTIDTYYDRTAEMLTAQRPDKIW - UNI33334 - WNFHVWNECWMI

RKDLPPGYNGWQVLDPTPQQTSSG GLFCCGPASVKAIKEGDVQLPYDTPFVYAEVNADEVVWLFEGGQVQEILAHNTSYIGKAISTKMVGSDERLDITS

SYKYPEG GSSEERSAFIKASWKLLEPRRNASSLLDLLGSENLKAKPVRLQLHLVRAPMWGQDLPLMLYVQRVPVRDHVQGSVGLTVRFCAQALLHGGGT

RKPFWRHIVHLNVDFEKE ELQWPFLLPYSSYRDKLTDERLIRVAGIAEVEETGQFILVLKDFSLEPPHLSIE - UNI13478 - VFERAEVGKALDI

HITLTNTLMVPLNNCTMVLEGSGLINGQMTKD DLGTLMAGHTIRIHLELYPIKAGPHQLQVLISSSEVKEIKGYKDILVAAAPAS

For any suggestions or comments, please send an email to unitrap@crg.es