Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000079252 (Ifrg15)
Chromosomal location
Chr 1: 157882856 - 157900866 (+)
Description
interferon alpha responsive gene Gene [Source:MGI (curated);Acc:Ifrg15-004]
RefSeq_dna
NM_022329 
RefSeq_peptide
NP_071724.1 
UniGene
Mm.458051 
MGI
MGI:1929890 
Uniprot/SPTREMBL
Q3U8P1 Q3UAA2 Q8BK77 Q9D178 Q9ER81 
Human Ortholog
ENSG00000218839 (AL359853.18)
Omim not available
UniTrap UNI30039
Vector Insertion
Chr 1: 157883051 - 157888046
Public Clones (sanger) D143C02 (ggtc) 5SE223B06 (ggtc) IST14377E8 (tigm) IST14980H1 (tigm)
IST14403E8 (tigm) IST11632B7 (tigm) IST11591F12 (tigm) IST13266H6 (tigm)
IST14540G9 (tigm) IST11596G9 (tigm) IST14593D1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2530
Vector Insertion
Chr 1: 157888133 - 157888204
Public Clones XS0666 (sanger) D035C02 (ggtc) P098C07 (ggtc) IST10477G1 (tigm)
Private Clones OST353833 (lexicon) OST139894 (lexicon) OST81596 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29468
Vector Insertion
Chr 1: 157888265 - 157898423
Public Clones (sanger) P148C04 (ggtc) IST13613A7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000097526
Sequence
GCAGACCAGCGCTGTGGAGCTGGAGGAACGGCCTAGTGGTACCGCTGATCCTGACTGTCCCGTGTTTTAAAACCTGGCTGGAAATT - UNI2530 - G

TCTTTGAGAAAGGATCCCTCCCCACCCCCACCTCCCCTACGGCACAAACAGAAATCGAG - UNI29468 - GTGTGTGACGCATTCCCAGACCATCCT

GCAAACTCAACACCAGCGACTTCTCTGTGACTGGGTCCAGATAAAGGTCCTTTCAAGACTGACTTCAGTGGATCTACTCCACCAGGTCTTCCCGACCTTA

CTACATCACTGCCAAGTGCTATTGGCGAGACTGCCTGCACCAGCAGAAGACTCACCGGATCCATCAGAGCGTCGGTTTTACCAGAGCAAAGCAAGAGCCT

GTGTGGTTCTGCCTCCCGCTAATACTGGACAGGAAACAGCAACTGGCTTGGACTAGAGGCCTGGCTTTCCTTTGAAGGAGCTATTCTGTGATCTGTGTTG

CTAGTAAGTGACTGACAGTATTCTAGACTGGACTGGTCCCTGAGTACAGAGACTGAGTTGCAATTAAGTGAAGAATAAACTTCAAGATCTTGAAGAACTG

CACTAAGGTGCAAGCCAGGTTCAGCACTCCAGTGTTGTTGAACTGACAAGTTGCTAAAGGAAACTGTAACTGGACTGACTGTTGCTTATTGCTTCCCTCT

CTCTGTCATTGTTGCTTTTTGTTGTTACATTGCTTTGTGTTGTCTTTCTAAGCCCAGATGTTCTCCGATAATTCACACTGCCCTGATTGTGGGCAGCAGT

GGTTCCCTAGTTTAGAACTAGGGCACTGGTTGTACCAAACTGAACTTGTTGAAAATGAATGTTACCAAGTGTTCTTAGACCGTATTAACAGGGCTGACTA

CTGCCCTGAGTGTTACCCTGACAATCCTGCTAATAGAAGCCTTGTTCTGCCTTGGTCTTTCCCACTTGAGTGGGCACCTCAAAATCTTACCAGGTGGACC

TTTGAAAAAGCTTGCCATCCATTTCTTCTGGGTCCTCCACTGGTTAGAAAAAAGATACATGACTCCAGGGTAGCTGGCTTTAATCCTGCATTACAATTAA

TTTTGTCCAGAACAGACAAAACCTTAAACAAGAAACTTGGCCAAAGCAAATGACTTCTGTAACAGAATCATGGAGACTCTCAAGGGCTTTGCGTTCGTAG

CCTAGGGGAGAAGAGGAATTAACGTGTTTCTGTTTTCCTTCTCTTTTTCTTTCTTATAATTTTTTAAGGTGCTGGGGATTGAATCTGGGTGCCTTGTGCA

TGCTAGGCAAGTGCTCTTCCACTAAGTTAAACCAAGGCTCCCCCTTTCTAAGACTGACTCAGACTGCTGTTACTACTCTGTCAACTGCCTAAATTGTTGG

GTCTGCTTCTGTGGTCTATGCATATTTTAGCATAAATTTAGTTGATATTGCAGCCAGAGTATTTACCTAGAACCAGACTAACCTATAGCCCCTATAAATG

CTTTAGAACTACCTGGCCCCTCTTGAAAATCACCACAACCTAAGTATTGACAAGATAATGTAGTCCTGGAGGGGAGGCCCCATGTTGTATGCCCCATAAA

CTGTTTTTCTATCAGTACCTGTTATGAGAACATGTTCTTGTAGCTGGATTCTAGATTCTAATAAATTTTAATACACTACATTGTTCTAATTTTCTCCTCT

TATATTGATCAATAATGAGAGATGTGTGTATGTACATGTAAATTTTTTTCATATATATATAACCATTCTTTGACACTTTTATCCTCAGTGTAAGTATTAC

AGTGTTTTAACTGGTCCTGTCACATACTATTTGGCAATACCTACACCGGTTACCAAAAAATGTGTTAATGCTGCCAGTTTACACTTACTTATCTCTATAT

AACCAAAGACTGTCTTGTCTTGTGGTGAGTGAACTCAGTGTCCTCCCATGGAAATGGAAAAATAACCCATGCTATGGAGTTTATGACAAATGATAAAGCT

TGACTCCATATAACTTTAGAGTGGTCTAGTGGATGCTCTGTCTTAGCCGTAAGAATGTGCTGCTGAACATTGGCCACGTTCTAGGATTCTGGTCATGGAA

ATCATGGAATCAGATTTGGAGTTAAGCAGCTTAGAAAAGGCTCCTGGGAACATCTGAGAAGCCACTGGACATTGTTAAATTTTCACTTAAGATTCTAGGT

GATCCAGTGCCTGTGTAGAAGCAGAAATGTCAAGGACCCAGGTGGTTCTCTTTCCTCTCTAGGGTCTTTATGGTCTTTGTTCTCATGATAGTTTTTAAAT

GGGTTCAGTATGGTTCGTTGTGCCGATAATTCAATCACAACCAGAAGCAGGGGGCACCTGGCTTGCTTTCTTACAAGTCTTAATTTGGAAATAAAATCTT

TTTGAAATGACTCAGCAGGTTTTATTGTTTTTGTTTTACTCTCATGAGCAGGTACTGATTCATGCACTAGTCTGAGAAAGACTTGGCAAAGGAGGAGGAA

GATTGGGCTTTCCCTTATGGCACCTCACCTCCGCTGATAAAACTGACATCCATCCCTTAAGTGGGGAAGTGGAGGACTAGTTGTTGATACGCAATAAATC

TTGCTTTCCACATGTG
Translation
 - UNI2530 -  - UNI29468 - MFSDNSHCPDCGQQWFPSLELGHWLYQTELVENECYQVFLDRINRADYCPECYPDNPANRSLVLPWSFPLEWA

PQNLTRWTFEKACHPFLLGPPLVRKKIHDSRVAGFNPALQLILSRTDKTLNKKLGQSK
Transcript ENSMUST00000111754
Sequence
CGCGCTCCCGAGCCCGCAGCCGAGACTGTTACCTTCGCGGTCCTCACTGGAGGACGGAGAGTCCCGTAACCCTCGGCCGCTCGTGGCCGGAGACAGCTGC

GGCTGCTGTGAGTGCTGCTCAAGGCGAGCAGACCTCCGCGTCTTCATCTCCTCGGCTTCCTGGGCTCGCCGCTGCCTCCGTGGTCGAGAGCGAAG - UN

I2530 - - UNI30039 - GTCTTTGAGAAAGGATCCCTCCCCACCCCCACCTCCCCTACGGCACAAACAGAAATCGAG - UNI29468 - GTGTG

TGACGCATTCCCAGACCATCCTGCAAACTCAACACCAGCGACTTCTCTGTGACTGGGTCCAGATAAAGGTCCTTTCAAGACTGACTTCAGTGGATCTACT

CCACCAGGTCTTCCCGACCTTACTACATCACTGCCAAGTGCTATTGGCGAGACTGCCTGCACCAGCAGAAGACTCACCGGATCCATCAGAGCGTCGGTTT

TACCAGAGCAAAGCAAGAGCCTGTGTGGTTCTGCCTCCCGCTAATACTGGACAGGAAACAGCAACTGGCTTGGACTAGAGGCCTGGCTTTCCTTTGAAGG

AGCTATTCTGTGATCTGTGTTGCTAGTAAGTGACTGACAGTATTCTAGACTGGACTGGTCCCTGAGTACAGAGACTGAGTTGCAATTAAGTGAAGAATAA

ACTTCAAGATCTTGAAGAACTGCACTAAGGTGCAAGCCAGGTTCAGCACTCCAGTGTTGTTGAACTGACAAGTTGCTAAAGGAAACTGTAACTGGACTGA

CTGTTGCTTATTGCTTCCCTCTCTCTGTCATTGTTGCTTTTTGTTGTTACATTGCTTTGTGTTGTCTTTCTAAGCCCAGATGTTCTCCGATAATTCACAC

TGCCCTGATTGTGGGCAGCAGTGGTTCCCTAGTTTAGAACTAGGGCACTGGTTGTACCAAACTGAACTTGTTGAAAATGAATGTTACCAAGTGTTCTTAG

ACCGTATTAACAGGGCTGACTACTGCCCTGAGTGTTACCCTGACAATCCTGCTAATAGAAGCCTTGTTCTGCCTTGGTCTTTCCCACTTGAGTGGGCACC

TCAAAATCTTACCAGGTGGACCTTTGAAAAAGCTTGCCATCCATTTCTTCTGGGTCCTCCACTGGTTAGAAAAAAGATACATGACTCCAGGGTAGCTGGC

TTTAATCCTGCATTACAATTAATTTTGTCCAGAACAGACAAAACCTTAAACAAGAAACTTGGCCAAAGCAAATGACTTCTGTAACAGAATCATGGAGACT

CTCAAGGGCTTTGCGTTCGTAGCCTAGGGGAGAAGAGGAATTAACGTGTTTCTGTTTTCCTTCTCTTTTTCTTTCTTATAATTTTTTAAGGTGCTGGGGA

TTGAATCTGGGTGCCTTGTGCATGCTAGGCAAGTGCTCTTCCACTAAGTTAAACCAAGGCTCCCCCTTTCTAAGACTGACTCAGACTGCTGTTACTACTC

TGTCAACTGCCTAAATTGTTGGGTCTGCTTCTGTGGTCTATGCATATTTTAGCATAAATTTAGTTGATATTGCAGCCAGAGTATTTACCTAGAACCAGAC

TAACCTATAGCCCCTATAAATGCTTTAGAACTACCTGGCCCCTCTTGAAAATCACCACAACCTAAGTATTGACAAGATAATGTAGTCCTGGAGGGGAGGC

CCCATGTTGTATGCCCCATAAACTGTTTTTCTATCAGTACCTGTTATGAGAACATGTTCTTGTAGCTGGATTCTAGATTCTAATAAATTTTAATACACTA

CATTGTTCTAATTTTCTCCTCTTATATTGATCAATAATGAGAGATGTGTGTATGTACATGTAAATTTTTTTCATATATATATAACCATTCTTTGACACTT

TTATCCTCAGTGTAAGTATTACAGTGTTTTAACTGGTCCTGTCACATACTATTTGGCAATACCTACACCGGTTACCAAAAAATGTGTTAATGCTGCCAGT

TTACACTTACTTATCTCTATATAACCAAAGACTGTCTTGTCTTGTGGTGAGTGAACTCAGTGTCCTCCCATGGAAATGGAAAAATAACCCATGCTATGGA

GTTTATGACAAATGATAAAGCTTGACTCCATATAACTTTAGAGTGGTCTAGTGGATGCTCTGTCTTAGCCGTAAGAATGTGCTGCTGAACATTGGCCACG

TTCTAGGATTCTGGTCATGGAAATCATGGAATCAGATTTGGAGTTAAGCAGCTTAGAAAAGGCTCCTGGGAACATCTGAGAAGCCACTGGACATTGTTAA

ATTTTCACTTAAGATTCTAGGTGATCCAGTGCCTGTGTAGAAGCAGAAATGTCAAGGACCCAGGTGGTTCTCTTTCCTCTCTAGGGTCTTTATGGTCTTT

GTTCTCATGATAGTTTTTAAATGGGTTCAGTATGGTTCGTTGTGCCGATAATTCAATCACAACCAGAAGCAGGGGGCACCTGGCTTGCTTTCTTACAAGT

CTTAATTTGGAAATAAAATCTTTTTGAAATGACTCAGCAGGTTTTATTGTTTTTGTTTTACTCTCATGAGCAGGTACTGATTCATGCACTAGTCTGAGAA

AGACTTGGCAAAGGAGGAGGAAGATTGGGCTTTCCCTTATGGCACCTCACCTCCGCTGATAAAACTGACATCCATCCCTTAAGTGGGGAAGTGGAGGACT

AGTTGTTGATACGCAATAAATCTTGCTTTCCACATGTG
Translation
 - UNI2530 - - UNI30039 -  - UNI29468 - MFSDNSHCPDCGQQWFPSLELGHWLYQTELVENECYQVFLDRINRADYCPECYPDNPANR

SLVLPWSFPLEWAPQNLTRWTFEKACHPFLLGPPLVRKKIHDSRVAGFNPALQLILSRTDKTLNKKLGQSK
Transcript ENSMUST00000065648
Sequence
TTCTGCCGTGGCGGCTGGGGGTTGCAGACCAGCGCTGTGGAGCTGGAGGAACGGCCTAGTGGTACCGCTGATCCTGACTGTCCCGTGTTTTAAAACCTGG

CTGGAAATT - UNI2530 - - UNI29468 - GTGTGTGACGCATTCCCAGACCATCCTGCAAACTCAACACCAGCGACTTCTCTGTGACTGGGTCC

AGATAAAGGTCCTTTCAAGACTGACTTCAGTGGATCTACTCCACCAGGTCTTCCCGACCTTACTACATCACTGCCAAGTGCTATTGGCGAGACTGCCTGC

ACCAGCAGAAGACTCACCGGATCCATCAGAGCGTCGGTTTTACCAGAGCAAAGCAAGAGCCTGTGTGGTTCTGCCTCCCGCTAATACTGGACAGGAAACA

GCAACTGGCTTGGACTAGAGGCCTGGCTTTCCTTTGAAGGAGCTATTCTGTGATCTGTGTTGCTAGTAAGTGACTGACAGTATTCTAGACTGGACTGGTC

CCTGAGTACAGAGACTGAGTTGCAATTAAGTGAAGAATAAACTTCAAGATCTTGAAGAACTGCACTAAGGTGCAAGCCAGGTTCAGCACTCCAGTGTTGT

TGAACTGACAAGTTGCTAAAGGAAACTGTAACTGGACTGACTGTTGCTTATTGCTTCCCTCTCTCTGTCATTGTTGCTTTTTGTTGTTACATTGCTTTGT

GTTGTCTTTCTAAGCCCAGATGTTCTCCGATAATTCACACTGCCCTGATTGTGGGCAGCAGTGGTTCCCTAGTTTAGAACTAGGGCACTGGTTGTACCAA

ACTGAACTTGTTGAAAATGAATGTTACCAAGTGTTCTTAGACCGTATTAACAGGGCTGACTACTGCCCTGAGTGTTACCCTGACAATCCTGCTAATAGAA

GCCTTGTTCTGCCTTGGTCTTTCCCACTTGAGTGGGCACCTCAAAATCTTACCAGGTGGACCTTTGAAAAAGCTTGCCATCCATTTCTTCTGGGTCCTCC

ACTGGTTAGAAAAAAGATACATGACTCCAGGGTAGCTGGCTTTAATCCTGCATTACAATTAATTTTGTCCAGAACAGACAAAACCTTAAACAAGAAACTT

GGCCAAAGCAAATGACTTCTGTAACAGAATCATGGAGACTCTCAAGGGCTTTGCGTTCGTAGCCTAGGGGAGAAGAGGAATTAACGTGTTTCTGTTTTCC

TTCTCTTTTTCTTTCTTATAATTTTTTAAGGTGCTGGGGATTGAATCTGGGTGCCTTGTGCATGCTAGGCAAGTGCTCTTCCACTAAGTTAAACCAAGGC

TCCCCCTTTCTAAGACTGACTCAGACTGCTGTTACTACTCTGTCAACTGCCTAAATTGTTGGGTCTGCTTCTGTGGTCTATGCATATTTTAGCATAAATT

TAGTTGATATTGCAGCCAGAGTATTTACCTAGAACCAGACTAACCTATAGCCCCTATAAATGCTTTAGAACTACCTGGCCCCTCTTGAAAATCACCACAA

CCTAAGTATTGACAAGATAATGTAGTCCTGGAGGGGAGGCCCCATGTTGTATGCCCCATAAACTGTTTTTCTATCAGTACCTGTTATGAGAACATGTTCT

TGTAGCTGGATTCTAGATTCTAATAAATTTTAATACACT
Translation
 - UNI2530 - - UNI29468 - MFSDNSHCPDCGQQWFPSLELGHWLYQTELVENECYQVFLDRINRADYCPECYPDNPANRSLVLPWSFPLEWAP

QNLTRWTFEKACHPFLLGPPLVRKKIHDSRVAGFNPALQLILSRTDKTLNKKLGQSK

For any suggestions or comments, please send an email to unitrap@crg.es