Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000079259 (Trim71)
Chromosomal location
Chr 9: 114420393 - 114473487 (-)
Description
tripartite motif-containing 71 Gene [Source:MGI Symbol;Acc:MGI:2685973]
RefSeq_dna
NM_001042503 
RefSeq_peptide
NP_001035968.1 
UniGene
Mm.17857 
MGI
MGI:2685973 
Uniprot/SWISSPROT
Q1PSW8 
Human Ortholog
ENSG00000206557 (TRIM71)
Omim not available
UniTrap UNI536
Vector Insertion
Chr 9: 114434240 - 114471422
Public Clones CA0010 (sanger) (sanger) XP0019 (sanger) AZ0432 (sanger) XR1152 (sanger)
AK0501 (sanger) RRI268 (baygenomics) RRK374 (baygenomics) RRR716 (baygenomics)
RRF011 (baygenomics) XM221 (baygenomics) RRT020 (baygenomics) RRF013 (baygenomics)
RRJ340 (baygenomics) XA144 (baygenomics) P116B12 (ggtc) 5SP137F04 (ggtc)
5SP117D04 (ggtc) 3SH008E07 (ggtc) 5SE167C07 (ggtc) 5SE069C10 (ggtc)
3SP116B12 (ggtc) 3SH003G09 (ggtc) H006F07 (ggtc) 5SP141D05 (ggtc)
5SP134D06 (ggtc) 5SP105B06 (ggtc) Q011A02 (ggtc) 3SP137F04 (ggtc)
3SP117D04 (ggtc) 5SH008C08 (ggtc) 5SE285B02 (ggtc) 3SE066G11 (ggtc)
5SP107B06 (ggtc) 5SD130D06 (ggtc) P134D06 (ggtc) 3SP141D05 (ggtc)
3SP134D06 (ggtc) 3SH009C10 (ggtc) 5SE305F04 (ggtc) 3SE130D06 (ggtc)
5SP116B12 (ggtc) 5SH006F07 (ggtc) 3SE284A07 (ggtc) 3SP137B05 (ggtc)
3SP107B06 (ggtc) IST14345E7 (tigm) IST10815B10 (tigm) IST14102F5 (tigm)
IST13328E8 (tigm) IST14447G8 (tigm) IST14486B6 (tigm) IST10088E4 (tigm)
IST14682D4 (tigm)
Private Clones OST468012 (lexicon) OST449469 (lexicon) OST379752 (lexicon) OST367027 (lexicon)
OST348852 (lexicon) OST316772 (lexicon) OST59118 (lexicon) OST38194 (lexicon)
Severity of mutation (?) Insertion after 32% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI803
Vector Insertion
Chr 9: 114424986 - 114434071
Public Clones CH0260 (sanger) (sanger) AA0094 (sanger) AN0208 (sanger) RRS310 (baygenomics)
5SP143E12 (ggtc) 5SH004C06 (ggtc) IST12376B6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 38% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37410
Vector Insertion
Chr 9: 114420392 - 114424986
Public Clones PST23688-NR (escells) PST17433-NR (escells) PST17073-NL (escells)
Private Clones not available
Severity of mutation (?) Insertion after 44% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000111816
Sequence
GTTTGCTCCTTTGGAGATTAAAAGGATTCCGAATTCCGATCAGTCCCAATAACCCGCGTTCTGAGAGGCGGCAAAGCGGAGAAAGAAGGGGGACACGCGC

ACGCACACAGCCCCTCGTTCGGGGGAGTCGTGCAAAATAAAGCCCAAAGCAACCCAGGACACCAGGGCATCGGGAGAGCCTGAGCCCGGTAGGCGCAGCG

CAGCCGGGGCCACCCGCATCCCCGCTCGGCGAATCGTTCGTAGGAGGATGACGCAGGCGGGAGCCGCGGGCGGCGTTGGCCACGCGGCTCCCGAAGTGGC

CGCGCGGGTCCCTCGCGTACTCCTCTGATTCGAGCAAGCCCGGGAGGGAGACTCGGTTCCCGAGGCTCCGGGATTGAAGGGGGGACCCAAGCGAGGGTGA

AATGGCCCGATGACAAAGGAAATGTGATCCTCCTTCGCTGCCCAGGTTTCGGAGAGGACGGCCGTGAGGAGGAGGGGCGCGCGGCTCGCGCGGAACGCGG

ATAGCATTGCACGACGGCCCCGCGCGGAGCGGGCGGCCCGTACATCCAATATCTTCCCGCCGATGAATAATTCAGGGCGGCCCGCGGGGACCTGCGGCCC

CGCGCCGCGGAGCGCCTGAGGCCGGAGAAGGGTCGGAGCGCGCGCTAGAGAGCGAGCCAGGAGGCCGGAGGACACGCGGGCGCCGGGCCGCGTGGGGCGC

GCGCGCGTGTGAGCGCATAGAGACCGCGGCCCGGCAGGGCTGCGCACGGGCGCGGAGCGTGTGGGGCGCGCGTGCGTACTTGGCACGCGTGCTTCCGCGG

GCCGGGGGCCCCCGCACGAGGCGCAGCTGCGCGCCCGAGCCGACCGCGCCGCGGGGGAGGCTGCGCCTCGGCCGCCACGCAGGAGCTCCTGCCGCCGCGT

CATGCGGCGGGGCGGCCGGCGGCGCGCGCGGGGACTTGGACTGCTGCGACTCCCGGACGTTTTCCCCTCCCTCCAGGAGGCTCAATTCATTTAGCCGGAG

GGCAAGGAAAAAAAAAAAACAACACAAGCAAGACTCGTTGGGACCAAATTGGTTTGCGCCGCGGGGACCGGATTCCACGGCGGACTTTGAGACTTGTGCG

GGCGCTCGTTTGCTGAGGAGTAGCAGTGCAAACCCGCCCTGCCGAGGTGGCCCAGGGGTCGCCTCCACCGCGTCCTCGATGCGCTCTGCTGAGTGAGCCG

CGCGCCCTCATCCTCCTCGCCGCGCGCCCTCTGCCCTCCAGCCCGCCTGCAAATGGCTTCGTTCCCGGAGACCGACTTCCAGATCTGCCTGCTGTGCAAG

GAGATGTGCGGCTCGCCCGCGCCGCTCTCCTCCAACTCGTCCGCCTCGTCGTCGTCCTCGCAGACTTCCACGTCGTCGGCGGGCGGCGGCGGCCCCGGGG

CGGCGGCGCGGCGTCTTCACGTCTTGCCCTGCCTGCACGCCTTCTGCCGGCCGTGCCTCGAGGCGCACCGGCTGCCCGCTCCCGGAGGCGCGGGCCCCGC

CGAGGCGCTGAAGCTGCGCTGCCCCGTATGTGACCAGAAGGTGGTCCTGGCCGAGGCGGCGGGCATGGACGCGCTGCCATCCTCCGCCTTCCTGCTCAGC

AACCTGCTGGACGCCGTGGTGGCCACCGCCGAAGAGCCGCCGCCCAAGAACGGGCGCGCGGGCGGCGGCCCCGGGGGCGCGGGCGGCCACAGCAACCACC

GGCACCATGCGCACCACCCGGCCCAGCGCGCCGCCGCTCCAGCGCCGCAGCCGCCGCCCGGCCCGGCCGCCTCCCCCGGGTCGCTGCTGATGCGCCGGCC

GCACGGCTGCAGCTCCTGCGACGAGGGCAACGCCGCCTCGTCGCGCTGCCTCGACTGCCAGGAACACCTGTGCGACAACTGTGTCCGCGCGCACCAGCGC

GTCCGCCTCACCAAGGACCATTACATCGAGCGCGGCCCTCCGGGGCCTGCGGCCGCCTCCGCGGCACAGCAGCTGGGGCTCGGGCCGCCCTTCGCGGGCG

CGCCCTTCTCCATTCTCTCGGTGTTCCCGGAGCGCCTCGGCTTCTGCCAGCACCACGACGATGAG - UNI536 - GTCCTGCATCTCTACTGTGACAC

CTGCTCTGTCCCCATCTGCAGAGAGTGCACGCTGGGCCGCCACGGTGGCCACAGCTTCGCCTACCTCCAGGATGCCCTGCAGGACTCTCGGGCACTCACC

ATCCAGCTGCTGGCTGATGCCCAGCAGGGCCGCCAGGCTCTCCAG - UNI803 - CTGAGCATCGAGCAGGCCCAGACTGTGGCAGAACAGGTGGAGA

TGAAGGCGAAGGTGGTCCAGTCTGAGGTCAAGGCCGTCACAGCTCGCCACAAGAAGGCCCTGGAGGATCGGGAGTGTGAGCTGTTGTGGAAG GTGGAGA

AGATCCGGCAGGTGAAGGCGAAGTCTCTGTTCCTGCAGGTGGAGAAGCTGCGGCAGAGTCTCAGCAAGCTGGAGAGCACCATCAGCGCCGTGCAGCAGGT

CCTGGAAGAGGGCCGCGCCCTGGACATCCTGCTGGCCCGAGACCGGATGCTGGCCCAGGTGCAGGAGCTCAAGACCATCCGAGGCCTCCTGCAGCCCCAA

GAAGATGACCGCATTATGTTCACGCCCCCTGACCAGGCCCTGTACCTCGCCCTCAAGTCTATTGGCTTTGTCAGCAGCGGGGCCTTCGCCCCGCTCACGA

AGGCTACAGGAGATGGCATCAAGCGTGCCCTTCAGGGGAAGGTGGCCTCTTTCACTGTCATGGGCTACGACCACGATGGTGAGCCCCGCCATTCGGGAGG

TGACCTGATGTCAGTTGTGGTCCTCGGCCCCGACGGAAACCTGTTTGGTGCAGAAGTGAGCGACCAGCAGAATGGTACTTACATAGTGAGCTACAGGCCC

CAGCTTGAGGGTGAGCACTTGGTGTCGGTGACATTGTACAATCAGCATATAGAGAACAGCCCCTTCAAGGTCGTGGTCAAGTCGGGCCGCAGCTACGTGG

GCATCGGGCTCCCCGGGCTGAGCTTCGGCAGTGAAGGTGACGGGGAGGGCAAGCTCTGCAGGCCCTGGGGCGTGAGTGTTGATAAGGAGGGTTTCATCAT

AGTGGCTGACCGAAGCAATAACAGAATCCAGGTGTTTAAGCCCTGTGGTTCCTTCCACCACAAGTTTGGTACCCTTGGGTCTCGTCCTGGGCAGTTTGAC

CGACCGGCTGGGGTGGCTTGTGACGCCTCCCGCAGGATCATAGTGGCCGACAAAGACAATCATCGCATTCAGATCTTCACCTTCGAGGGCCAGTTCCTTC

TTAAGTTTGGTGAGAAAGGCACCAAGAACGGGCAGTTTAACTACCCGTGGGATGTAGCAGTGAATTCTGAGGGCAAGATCCTCGTTTCAGACACCCGGAA

TCATCGCATCCAGTTGTTCGGACCGGACGGGGTCTTCCTGAACAAGTACGGCTTCGAGGGATCTCTCTGGAAGCACTTCGACTCTCCACGGGGCGTGGCT

TTCAACAATGAAGGTCACCTGGTAGTCACCGACTTCAACAACCACCGGCTTCTGGTTATTCACCCTGATTGCCAATCTGCCCGCTTCTTGGGTTCGGAGG

GCTCGGGCAATGGGCAGTTCCTGCGACCACAGGGTGTGGCTGTGGACCAGGAAGGGAGAATCATCGTAGCCGATTCCAGAAATCACCGCGTGCAGATGTT

TGAGGCCAATGGCAGCTTCCTGTGCAAGTTTGGTGCTCAAGGGAGTGGCTTCGGGCAGATGGACCGCCCCTCAGGTATCGCGGTCACCCCGGATGGATTG

ATCGTCGTGGTGGACTTTGGCAACAATCGAATCCTCATCTTCTAATTGTGTCTTCTGGGGTTTTCTGTGTTTAGGGTGTGCATGTGTGTGTCTCTCATTT

TTGAATTTCAAAGAAGAAATCGTCTCAGGGATATTTCTTTTTCTTTTTCCCCCCCTTTATTTTTATTATTTTTTTTTTTTTAAGAACAAAAGTACAACAT

TGCCTAAGTCCTACCTCAGCTTAAATTTTTTTTTTTTTTTTTTTTTTACAGATGAATGTAATTCTCCTCTGTGCAGGGCTTGAGCCTGTGAAGTGATAAT

TTCTATCTACCTCAACTCTTTGCATTTCCCTCTCTGGCAAGCCTCTTGGCTCACATCCTCTTCCCTCCTGAAGGCCTAGGAGGCACAGGACAGCGGTCCT

GCAACCTTGAGGGCACTGGAAGCATATGGTGGGGTGCATGCATTTTGTAGATTGAGCCAAGGAAACCCAAAAACTACTAAGTAAAAAAGAGAAGTATAAG

ATGTTGGAAAGATAGGATTTAAAATTCATAATTGTAGTGTATTTGTGTTCTTGAGAATACTGTGTTTATGTGGGGTTAGGTTGTGTGTGGTTTGCTCTTT

TCTTTTTTATCGATGCAACAGGGCTTTTCTCTGTTTACCTCAGTGTGTCTGACATCTCATCCCTAGGAGATATGGCTGTGGCTTGCTAGCCTAGAAAAGC

AGACCATTCATATTTTCGGGTGTCTCATCTTTGTATCTGGTAAAGAAGGGTGGGTGTGTGGGAGTGTGTGTGTGCACACGCGTGCATGTTTGTGTTTCAA

AGCCATCTTTGCTTGAGGAGAAAAGCTGGACTTGACACAAGACATCCCAAGCAAATTTCTTCCCAGTTTGCTAAGAAACTCGATTTAGCTCAGGACTCTA

GGTTGAAAGTGTTCGCAAAGGTTACGTGTCTGTGTTTTTGTTGTTTGTTATAAAGACTTAGGTATAAGAAAATAAGTTAACCTTGTTCTCAGAGAGAGAG

GGGCTTTTCAGATGTGGACCAGGGTGCCACAGAAGTGGGGGGTGCTGGAGAAGTGAGGCACCCCCACATCAGGGACTGTTCAGGAGGGCGGGGGACCTCG

TCTCTATGTGTGAGGGTGTGGTAGGCAAAGGGATAGCTTTGATTTGAGAAGCACAATGTTTTTTCCTGCTTTGGAAGTTCAGGGAATGTAGAAGATTGTC

TGACTGGTGGGAGCACCTCACTCCCTAACCCTTGGCTCAGGTCTGTTTCTCAGGAACCTTCCCTAAGTCTGAGTGGAGGCAGACCTCAAGGTTAACACAA

AGCCCCGTTCCTCCCCCAAAGGCCTTTGAATGTAAAGGATTTACAAACCAAACCACCCAACAGGAAGTGTAGGACACAGTATATGTCTTTTTTTTTTTTT

AATTTTATTTTATTT
Translation
MASFPETDFQICLLCKEMCGSPAPLSSNSSASSSSSQTSTSSAGGGGPGAAARRLHVLPCLHAFCRPCLEAHRLPAPGGAGPAEALKLRCPVCDQKVVLA

EAAGMDALPSSAFLLSNLLDAVVATAEEPPPKNGRAGGGPGGAGGHSNHRHHAHHPAQRAAAPAPQPPPGPAASPGSLLMRRPHGCSSCDEGNAASSRCL

DCQEHLCDNCVRAHQRVRLTKDHYIERGPPGPAAASAAQQLGLGPPFAGAPFSILSVFPERLGFCQHHDDE - UNI536 - VLHLYCDTCSVPICREC

TLGRHGGHSFAYLQDALQDSRALTIQLLADAQQGRQALQ - UNI803 - LSIEQAQTVAEQVEMKAKVVQSEVKAVTARHKKALEDRECELLWK VEK

IRQVKAKSLFLQVEKLRQSLSKLESTISAVQQVLEEGRALDILLARDRMLAQVQELKTIRGLLQPQEDDRIMFTPPDQALYLALKSIGFVSSGAFAPLTK

ATGDGIKRALQGKVASFTVMGYDHDGEPRHSGGDLMSVVVLGPDGNLFGAEVSDQQNGTYIVSYRPQLEGEHLVSVTLYNQHIENSPFKVVVKSGRSYVG

IGLPGLSFGSEGDGEGKLCRPWGVSVDKEGFIIVADRSNNRIQVFKPCGSFHHKFGTLGSRPGQFDRPAGVACDASRRIIVADKDNHRIQIFTFEGQFLL

KFGEKGTKNGQFNYPWDVAVNSEGKILVSDTRNHRIQLFGPDGVFLNKYGFEGSLWKHFDSPRGVAFNNEGHLVVTDFNNHRLLVIHPDCQSARFLGSEG

SGNGQFLRPQGVAVDQEGRIIVADSRNHRVQMFEANGSFLCKFGAQGSGFGQMDRPSGIAVTPDGLIVVVDFGNNRILIF

For any suggestions or comments, please send an email to unitrap@crg.es