Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000079357 (AC171681.1)
Chromosomal location
Chr 14: 14750958 - 14782072 (+)
Description
not available
UniGene
Mm.406650 
Human Ortholog
ENSG00000163632 (C3orf49)
Omim not available
UniTrap UNI31884
Vector Insertion
Chr 14: 14751083 - 14754050
Public Clones IST10783B5 (tigm) IST12247C10 (tigm) IST10513H1 (tigm) IST13685B4 (tigm)
IST14433E11 (tigm) IST14251B7 (tigm) IST12969B5 (tigm) IST10301C12 (tigm)
IST13919D8 (tigm) IST12799C5 (tigm) IST13410G12 (tigm) IST13436C5 (tigm)
IST13353C3 (tigm) IST13171C6 (tigm) IST10204G4 (tigm) IST10372C3 (tigm)
IST12436G1 (tigm) IST13239D11 (tigm) IST13830A1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 14% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000112652
Sequence
ATGGAGCGCCCTCCGTTTTGTCAAAGTGAACTCCTAAAGCTTGCCTGTGGGAAGACTGGCCAGTACCAAGGAATCCAGCAACCCAATAGGAAAACTGGCT

CATTCAAAGGGAAGGTGATAGAGAG - UNI31884 - ATGGCATAGAGCTGTGTCCACCAACTTAGCCAAGCAAAATGTGTTGGTCCTCAAAGAGGAA

TCATTGAATGAAAGCAACTTGGGATTTCATGAAAGCCAAAGCAACCCAAAGAGAAACCTGGTAAAGAAGATGAAGAGTGCTGTTGGGAAAATGCTGTCTT

GCAAGTGTGGAAGCCAGTCAGCCAGTGCTGGCAGGGAGAGCTTTGTGGAGCAGAGGGAAGCCTCCCCGTCCAAAGCACCGGGCCTGCTGCCTAGACTTGT

GAAGGAGCTTCCATCGCCCAGATTATTCACCAATCCAAGCATGAAGAAGCTCTCACAAAATG CAACAATACAGCTTGATGTTGTAGAAGCAGAGACAGA

AGAGGTAACTGGAGGAAATGGGCTTCTCCGCGCCAAGAGAACCACCAAGCGATTATCTGTGACATCACTTCCTTCAGGGCTGCAGAAG GCACAATATTC

ATCAAAAAAGAGACCACACTTCCCAGCACTTAAAAAGAAGAAGCGGAGCATGGAAGCCATTCTCCAGAAATCAGAGCTGACCGTAGGCAAGCTTCAAATG

CAG GTGGATGACCTCATAGAAACAGTGACTGACAAATCCATGAAGCTTCTGGAACAAAGGCACGCTGAGCTTAAGCAGTGTGAGTTTCTAGGGGCTGAG

ATCCTTCAGTCTTCGAAGCAATTCCAAAGGCTTTCCAAGAGAACCACGAGGAAGTATAAGCTGCGACGAGCATGCTTCCCATGCACCTGCTGCTGCTGCT

GCTGAGTTCCCAGTACACAGCTCAGCTACCAAGGGGAGGGACCCTGCCTCAAACAGGGTAGACAAGCAGCAGCCAACGCTACCATCTGAATCTAGCCACA

TGCTACAGCAGGTGCACGCCCTCACACATAAGCATGCAAACATATGTACCATGTATGCATGCTCCCAAAGAAGTATTTTTTAAAAAGATTCTTTAAAACA

AAATGATAGAAGAAGCATTTACCAACCACATTCCTCAAGGACTAAGAGAGAGCTGTAGAAAAGCAACACAGATGGACTGATTTCATACGACAGCCATTCT

TAACAGTGTGAAAGCTTCCCCTACAATAGACCCACGCCATAAGTACTCATCATGGCCCTCTAAGGCCTACTCATGGACTCCATTTTCTCAAGTTTTACTA

ACATCTTCTAGAAATCTATTCATTTTCTCATGTGTATCCCAAACGCCATCTTAGATAATCCTTACCTGGTTCGCTAAGGCAAGTGTTAGCAGTTACCTAG

AGTTTTGAATGAGCACAAAGATCCACCTTGAGACATTTTATTAAATATTTTCAGATGCTGATTTCTATGTTTAAGGATAAAAATGTATTTAAAAAATACA

TATATATGGGATACATTTCCGTTCTGTGAAGAAATATGAACGACACATGAATACTTGAAAGCAAAGTACTTCAATGCTGAAGTTGAAATATCCCAAAAGT

ACAACACACTGAACCCAGGAAGCCCATGCAGCTATTCGCTGTCCCTGTAAATGGCGACGGTCAGTCCATCTATGGCTTAGGGTCTGCTTCCATGGTGCTT

TCTTGAGCTTCATCCACCTCTGACAGCTTGTCATCATCTGTAGTTAAGAAGACACAGAACCTTACTCCATGTCACCTACATTTTGTGCCTAGTAATGCAT

GAGAAGTTTTATTTTGCATTAGCAAATATGGTTATGTATGCAGCCCCTGCGCAACCCCCACAACGTAATTGTTATAGTTGATTATTTTTACATATTATTA

AGAGCATATAATTTGTGTGATAGATTTCATTAAAACCAAAGAACTAAAATCTAGGTCTTAGCCTGATT
Translation
MERPPFCQSELLKLACGKTGQYQGIQQPNRKTGSFKGKVIER - UNI31884 - RWHRAVSTNLAKQNVLVLKEESLNESNLGFHESQSNPKRNLVKK

MKSAVGKMLSCKCGSQSASAGRESFVEQREASPSKAPGLLPRLVKELPSPRLFTNPSMKKLSQNA ATIQLDVVEAETEEVTGGNGLLRAKRTTKRLSVT

SLPSGLQK AQYSSKKRPHFPALKKKKRSMEAILQKSELTVGKLQMQ VDDLIETVTDKSMKLLEQRHAELKQCEFLGAEILQSSKQFQRLSKRTTRKYK

LRRACFPCTCCCCC

For any suggestions or comments, please send an email to unitrap@crg.es