Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000079442 (St6galnac4)
Chromosomal location
Chr 2: 32442608 - 32452723 (+)
Description
ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 4 Gene [Source:MGI (curated);Acc:St6galnac4-001]
RefSeq_peptide
NP_035503.1 
UniGene
Mm.27446 
MGI
MGI:1341894 
Uniprot/SWISSPROT
Q9R2B6 
Uniprot/SPTREMBL
Q8C3J2 Q9JHP1 Q9JHP2 Q9JHP3 Q3TT62 Q3U6Q6 Q3UMI2 
Human Ortholog
ENSG00000136840 (ST6GALNAC4)
Omim not available
UniTrap UNI21833
Vector Insertion
Chr 2: 32445151 - 32449509
Public Clones not available
Private Clones OST316106 (lexicon)
Severity of mutation (?) Insertion after 22% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000102818
Sequence
AGCTTCAGGCTTCAGAAGCTGCGGCCGCAGCACCGCCTCCTACCCGGGGCCCGGTTCCAGCCCCTCTGGCCCGGCGCACTGGACATGGAGCTCCGAGCAG

CGCATCCTGAGCCCCCAGCGCACTCCAATCCGCTCGTTCG TTTCTCTCATATCCTGGGACCAGCTTCCAGCCTTTCTCATCCCAAGCACTGGAGACAGC

AGCCTCCAGACTGCTAAGAGCAGAGACAGCATGAAGGCCCCG GGCCGCCTTCTGCTCCTCACACTGTGCATCTTGACATTCTCTGCTGTCTGTGTCTTC

CTGTGCTGCTGGGCCTGCCTGCCGCTCTGCCTGGCAACCTGCCTGGACCGCCACCTCCCTGCGGCCCCCAGATCCACTGTGCCAGGGCCCCTGCACTTCA

GTGGCTACAGCAGCGTGCCAGACGGGAAG - UNI21833 - CCTCTTATCCGAGAACTGTGCCACAGCTGTGCGGTGGTGTCCAGCTCTGGCCAGATG

CTGGGTTCAGGCCTGGGTGCCCAGATCGATGGCGCAGAGTGCGTGCTACGCATGAACCAGGCACCCACCGTGGGCTTTGAGGAGGACGTGGGCCAGCGCA

GCACTCTGCGCGTGATCTCTCACACAAGTGTGCCATTGCTTCTGCGCAACTACTCACACTATTTCCAGCATGCCCGAGACACGCTCTACGTGGTGTGGGG

CCAGGGCAGGCACATGGACAGGGTGCTGGGCGGCCGCACCTACCGAACGTTGCTGCAGCTCACCAGAATGTATCCAGGCCTGCAAGTGTACACCTTCACT

GAACGCATGATGGCCTACTGTGACCAGATCTTCCAAGATGAGACAGGCAAGAACCG GAGACAATCAGGCTCCTTTCTCAGCACCGGTTGGTTCACCATG

ATTCTGGCCCTGGAGCTGTGCGAGGAGATCGTGGTCTACGGGATGGTCAGCGATAGTTACTGCAG CGAGAAGAGTCCCCGCTCCGTGCCCTACCACTAC

TTTGAGAAGGGCCGGCTAGATGAGTGTCAGATGTACCGTTTGCATGAGCAGGCTCCAAGGAGCGCCCATCGCTTCATTACCGAGAAGGCTGTGTTCTCCC

GCTGGGCCAAGAAGCGACCCATCGTGTTCGCCCACCCGTCCTGGAGGGCCAAGTAG
Translation
 MKAP GRLLLLTLCILTFSAVCVFLCCWACLPLCLATCLDRHLPAAPRSTVPGPLHFSGYSSVPDGK - UNI21833 - PLIRELCHSCAVVSSSGQ

MLGSGLGAQIDGAECVLRMNQAPTVGFEEDVGQRSTLRVISHTSVPLLLRNYSHYFQHARDTLYVVWGQGRHMDRVLGGRTYRTLLQLTRMYPGLQVYTF

TERMMAYCDQIFQDETGKNR RRQSGSFLSTGWFTMILALELCEEIVVYGMVSDSYCS SEKSPRSVPYHYFEKGRLDECQMYRLHEQAPRSAHRFITEK

AVFSRWAKKRPIVFAHPSWRAK
Transcript ENSMUST00000113292
Sequence
CCGTTTTTCTTGATCTGGATTTGT TCCCTTGCCTCAGTTTCTCTCATATCCTGGGACCAGCTTCCAGCCTTTCTCATCCCAAGCACTGGAGACAGCAGC

CTCCAGACTGCTAAGAGCAGAGACAGCATGAAGGCCCCG GGCCGCCTTCTGCTCCTCACACTGTGCATCTTGACATTCTCTGCTGTCTGTGTCTTCCTG

TGCTGCTGGGCCTGCCTGCCGCTCTGCCTGGCAACCTGCCTGGACCGCCACCTCCCTGCGGCCCCCAGATCCACTGTGCCAGGGCCCCTGCACTTCAGTG

GCTACAGCAGCGTGCCAGACGGGAAG - UNI21833 - CCTCTTATCCGAGAACTGTGCCACAGCTGTGCGGTGGTGTCCAGCTCTGGCCAGATGCTG

GGTTCAGGCCTGGGTGCCCAGATCGATGGCGCAGAGTGCGTGCTACGCATGAACCAGGCACCCACCGTGGGCTTTGAGGAGGACGTGGGCCAGCGCAGCA

CTCTGCGCGTGATCTCTCACACAAGTGTGCCATTGCTTCTGCGCAACTACTCACACTATTTCCAGCATGCCCGAGACACGCTCTACGTGGTGTGGGGCCA

GGGCAGGCACATGGACAGGGTGCTGGGCGGCCGCACCTACCGAACGTTGCTGCAGCTCACCAGAATGTATCCAGGCCTGCAAGTGTACACCTTCACTGAA

CGCATGATGGCCTACTGTGACCAGATCTTCCAAGATGAGACAGGCAAGAACCG GAGACAATCAGGCTCCTTTCTCAGCACCGGTTGGTTCACCATGATT

CTGGCCCTGGAGCTGTGCGAGGAGATCGTGGTCTACGGGATGGTCAGCGATAGTTACTGCAG CGAGAAGAGTCCCCGCTCCGTGCCCTACCACTACTTT

GAGAAGGGCCGGCTAGATGAGTGTCAGATGTACCGTTTGCATGAGCAGGCTCCAAGGAGCGCCCATCGCTTCATTACCGAGAAGGCTGTGTTCTCCCGCT

GGGCCAAGAAGCGACCCATCGTGTTCGCCCACCCGTCCTGGAGGGCCAAGTAG
Translation
PFFLIWIC SLASVSLISWDQLPAFLIPSTGDSSLQTAKSRDSMKAP GRLLLLTLCILTFSAVCVFLCCWACLPLCLATCLDRHLPAAPRSTVPGPLHF

SGYSSVPDGK - UNI21833 - PLIRELCHSCAVVSSSGQMLGSGLGAQIDGAECVLRMNQAPTVGFEEDVGQRSTLRVISHTSVPLLLRNYSHYFQH

ARDTLYVVWGQGRHMDRVLGGRTYRTLLQLTRMYPGLQVYTFTERMMAYCDQIFQDETGKNR RRQSGSFLSTGWFTMILALELCEEIVVYGMVSDSYCS

 SEKSPRSVPYHYFEKGRLDECQMYRLHEQAPRSAHRFITEKAVFSRWAKKRPIVFAHPSWRAK
Transcript ENSMUST00000113293
Sequence
AGCTTCAGGCTTCAGAAGCTGCGGCCGCAGCACCGCCTCCTACCCGGGGCCCGGTTCCAGCCCCTCTGGCCCGGCGCACTGGACATGGAGCTCCGAGCAG

CGCATCCTGAGCCCCCAGCGCACTCCAATCCGCTCGTTCG TTTCTCTCATATCCTGGGACCAGCTTCCAGCCTTTCTCATCCCAAGCACTGGAGACAGC

AGCCTCCAGACTGCTAAGAGCAGAGACAGCATGAAGGCCCCG GGCCGCCTTCTGCTCCTCACACTGTGCATCTTGACATTCTCTGCTGTCTGTGTCTTC

CTGTGCTGCTGGGCCTGCCTGCCGCTCTGCCTGGCAACCTGCCTGGACCGCCACCTCCCTGCGGCCCCCAGATCCACTGTGCCAGGGCCCCTGCACTTCA

GTGGCTACAGCAGCGTGCCAGACGGGAAG - UNI21833 - CCTCTTATCCGAGAACTGTGCCACAGCTGTGCGGTGGTGTCCAGCTCTGGCCAGATG

CTGGGTTCAGGCCTGGGTGCCCAGATCGATGGCGCAGAGTGCGTGCTACGCATGAACCAGGCACCCACCGTGGGCTTTGAGGAGGACGTGGGCCAGCGCA

GCACTCTGCGCGTGATCTCTCACACAAGTGTGCCATTGCTTCTGCGCAACTACTCACACTATTTCCAGCATGCCCGAGACACGCTCTACGTGGTGTGGGG

CCAGGGCAGGCACATGGACAGGGTGCTGGGCGGCCGCACCTACCGAACGTTGCTGCAGCTCACCAGAATGTATCCAGGCCTGCAAGTGTACACCTTCACT

GAACGCATGATGGCCTACTGTGACCAGATCTTCCAAGATGAGACAGGCAAGAACCG GAGACAATCAGGCTCCTTTCTCAGCACCGGTTGGTTCACCATG

ATTCTGGCCCTGGAGCTGTGCGAGGAGATCGTGGTCTACGGGATGGTCAGCGATAGTTACTGCAG CGAGAAGAGTCCCCGCTCCGTGCCCTACCACTAC

TTTGAGAAGGGCCGGCTAGATGAGTGTCAGATGTACCGTTTGCATGAGCAGGCTCCAAGGAGCGCCCATCGCTTCATTACCGAGAAGGCTGTGTTCTCCC

GCTGGGCCAAGAAGCGACCCATCGTGTTCGCCCACCCGTCCTGGAGGGCCAAGTAG
Translation
ASGFRSCGRSTASYPGPGSSPSGPAHWTWSSEQRILSPQRTPIRSFV VSLISWDQLPAFLIPSTGDSSLQTAKSRDSMKAP GRLLLLTLCILTFSAVC

VFLCCWACLPLCLATCLDRHLPAAPRSTVPGPLHFSGYSSVPDGK - UNI21833 - PLIRELCHSCAVVSSSGQMLGSGLGAQIDGAECVLRMNQAP

TVGFEEDVGQRSTLRVISHTSVPLLLRNYSHYFQHARDTLYVVWGQGRHMDRVLGGRTYRTLLQLTRMYPGLQVYTFTERMMAYCDQIFQDETGKNR RR

QSGSFLSTGWFTMILALELCEEIVVYGMVSDSYCS SEKSPRSVPYHYFEKGRLDECQMYRLHEQAPRSAHRFITEKAVFSRWAKKRPIVFAHPSWRAK

For any suggestions or comments, please send an email to unitrap@crg.es