Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000079454 (Ick)
Chromosomal location
Chr 9: 77961122 - 77972954 (+)
Description
intestinal cell kinase Gene [Source:MGI (curated);Acc:Ick-003]
Human Ortholog
not available
Omim not available
UniTrap UNI36179
Vector Insertion
Chr 9: 77961263 - 77972762
Public Clones IST14641H1 (tigm) IST11558A6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 37% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000009972
Sequence
GGAGGCCGCGGAGCGGCGGGTTCCTGCTGGATGCCACGCGCTGACGGGTGTGGACTTGCCGGGTTCGCCCGCTCGGATCCCACTGCCCTTGCCTGCCGGG

CCCTCTCGGGTGCACGCGCCGCCGGGCCGCGATCGCCGCCA - UNI36179 - TGTGGAAAACAATTGTGGAGAAGAAAATGGCTCCCTGAGCTGAGT

GGTCCTAATCTCAGGAGCTGTCCGTCCAGAGGGAGCCTGATCTTTTCTCTAATATCACTTTGCAGACTTGGAAAATCCTGTGGCTCCCCAACCTCCTTCA

CCTCCAGCATCCTGTGCTCTCATGGAGGGCCTCACTGTGTTCTTTAA
Translation
MPRADGCGLAGFARSDPTALACRALSGARAAGPRSPP - UNI36179 - CGKQLWRRKWLPELSGPNLRSCPSRGSLIFSLISLCRLGKSCGSPTSFT

SSILCSHGGPHCVL

For any suggestions or comments, please send an email to unitrap@crg.es