Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000079469 (AC158997.2)
Chromosomal location
Chr 9: 72862474 - 72887458 (-)
Description
GPI mannosyltransferase 3 (EC 2.4.1.-)(GPI mannosyltransferase III)(GPI-MT-III)(Phosphatidylinositol-glycan biosynthesis class B protein)(PIG-B) [Source:UniProtKB/Swiss-Prot;Acc:Q9JJQ0]
RefSeq_dna
NM_018889 
RefSeq_peptide
NP_061377.2 
Uniprot/SWISSPROT
Q9JJQ0 
Human Ortholog
ENSG00000069943 (PIGB)
Omim not available
UniTrap UNI35307
Vector Insertion
Chr 9: 72886429 - 72887459
Public Clones IST14353A11 (tigm) IST11748A4 (tigm) IST12411H11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000098566
Sequence
ATGTGTCCGCCTACAAGAAAGTGAGGGGCGGGCACCGTGGGCTGCAGGTAGCCGGGGAGGATGGAGTCCCAGGCCGCCGACTATAACCCGGCCTCCCGCA

ATCTCCACGGCAGCTCGGGAGAAATGAAGCTGCGGAGGAGGAAGTCCAGGCAGTACGTGAGCGCGCAGGAGAAACGCTCTCCGCGCCGTG - UNI3530

7 - GTCTTCTTGGAGAAAACACTTACCTGGTCTTGTTTACCATCGCTCTGCGAATACTTAACTGCTTCTTAGTGCAGACAAGCTTTGTTCCTGATGAAT

ACTGGCAGTCCCTCGAAGTTGCACACCGCATGGTTTTCAG - UNI35307 - TTATGGTTATTTGACCTGGGAATGGACGGAGCGATTGAGAGGCTAC

ACTTACCCCCTCATCTTCGCCAGTATTTACAAGGTTCTGCATCTTCTGGGGAAAGACAGTGTTCAATTCCTG ATCTGGATTCCCAGACTTGGCCAAGCT

CTTCTGTCTGCTGTAGCGGATATAAGGCTCTACTCCCTCCTGAAGCAGCTGGAAAACCAGGAAGTGGCACAATGGGTG TTCCTCTGCCAGCTGTGCTCC

TGGTTCACATGGTACTGCTGCACACGGACCCTCACGAACACCATGGAGACCTCCCTCACTGCCCTCGCCCTTTTCTACTATCCTCTGGAAGGCTCGAGGT

CCGTGAACAG CGTCAAGTACTCGCTCCTGGTGGCACTTGCTTGTGTGGTCCGCCCCACAGCTCTTATCCCATGGGTGCCGCTGCTCTTCAGACATTTCT

ACCAAGAACAGAGAAAGCTCCATCTGACTCTGCATCATTTTTTACCTGTAGG ATTTATAACCTTCAGTTTGTCTCTGATAATTGACCGTATCTTTTTTG

GCCAA TGGACGCTGGTCCAATTAAATTTCTTGAAATTTAACGTGCTGCAGAACCTAGGGACGTTTTATGGCTCCCATCCATGGCACTGGTACCTCAGTC

AAGGGTTCCCAGTTGTCCTGGGGACCCACTTACCTTTCTTCATTCACGGTTGCTTCCTAGCCCCAAGGAGGCTCCACATACTGCTGCTGACCGTGCTGTG

GACACTGCTGGTATACAG CATGTTGGGCCACAAAGAATTCAGGTTTATCTATCCAGTTTTACCATTCTGCATGGTGTTCTGTG GTTACTCACTAGCCC

ACCTGAAGACATGGAGGAAGGCAGCCCTGAGCTTCCTGCTCTTGTCAAATGTGCCACTGGCATTCTACACTGGCCTAGTTCATCAGAGAGGCACCCTGGA

TGTCATGAATCACATTCAGAAAGTCTGCCCCCGAGGTCCTGACCCAGCTTCGGCCTCAGTATTCATAATGATGCCCTGCCACTCCACGCCTTACTACAG 

CCATGTTCACTGCCCACTGTCCATGCGGTTTCTCCAGTGTCCCCCAGACTTGACTGGAAAAACTCAGTATCTTGATGAAGCAGATATGTTCTACTTAAAC

CCCTTAAGATGGTTACAACAAGAATTTCACAGCAATGCGTCACTCCCCACTCACTTGGTCACCTTCAATGTTCTGGAGAAG GAGATCAATACCTTCCTC

ACCTCAGGGAACTACGAGAGGGCCGCTACATTCTTCCACACTCACTGGCCAGAGCGCCGAACTGGAAGTCACATACACGTCTACGAGCGAAGGTTACCCG

GCAGGGTCAACACAGGAGGGAACTGAACT GAAGCATAAGAACAACCAGCCTCGTCTCCATCGGCTTTATCCCTCAATGAGAGAAGAGACACAGCTCGCA

GAGCAGTCTCCAACCTTCCCCCGTTCCAGGCAAGTGCAGTGAGCAGGCACTGCTGTCTTCCCACTCTGCCTGCTGGCTCCTCCACTGCCTTACGCCAGGA

CCTGCACACAAGCGCTCTGCAGCGCTCAGCTCTAAGCACCTGACTTGACATCTCTGGGTTCACGTGCATCACTCTGCACTCTTCTCGCTTAGCCTTCTCT

CTAACCAGCACAGATAGCATTGTCCCCTGCACTAGACCAATGGGGACTGGCTTCGAAGTGAGTAGAAATGGCCATGTACCTACCAACCCGTCCTCTCCAA

ATAAATGTCAACAG
Translation
MESQAADYNPASRNLHGSSGEMKLRRRKSRQYVSAQEKRSPRRG - UNI35307 - GLLGENTYLVLFTIALRILNCFLVQTSFVPDEYWQSLEVAHR

MVFS - UNI35307 - SYGYLTWEWTERLRGYTYPLIFASIYKVLHLLGKDSVQFL IWIPRLGQALLSAVADIRLYSLLKQLENQEVAQWV FLCQL

CSWFTWYCCTRTLTNTMETSLTALALFYYPLEGSRSVNS SVKYSLLVALACVVRPTALIPWVPLLFRHFYQEQRKLHLTLHHFLPVG GFITFSLSLII

DRIFFGQ WTLVQLNFLKFNVLQNLGTFYGSHPWHWYLSQGFPVVLGTHLPFFIHGCFLAPRRLHILLLTVLWTLLVYS SMLGHKEFRFIYPVLPFCMV

FCG GYSLAHLKTWRKAALSFLLLSNVPLAFYTGLVHQRGTLDVMNHIQKVCPRGPDPASASVFIMMPCHSTPYYS SHVHCPLSMRFLQCPPDLTGKTQ

YLDEADMFYLNPLRWLQQEFHSNASLPTHLVTFNVLEK EINTFLTSGNYERAATFFHTHWPERRTGSHIHVYERRLPGRVNTGGN 

For any suggestions or comments, please send an email to unitrap@crg.es