Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000079500 (AC114408.18)
Chromosomal location
Chr 5: 64040579 - 64191881 (+)
Description
Putative uncharacterized protein  [Source:UniProtKB/TrEMBL;Acc:Q8CC18]
Uniprot/SPTREMBL
Q8CC18 Q8CC58 
Human Ortholog
not available
Omim not available
UniTrap UNI33721
Vector Insertion
Chr 5: 64042523 - 64116396
Public Clones IST15055C11 (tigm) IST13016D10 (tigm) IST10831C4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000101196
Sequence
GGGGAGAGAGCGCCGAGGCGAGACGTGTCCTCCCACGCCACGAGAGGCAGGGAGAACCTTTCTCAATGCCTGGAGCTTTAATGCTCCAGCCCCTTGGCGT

GTGGTGTGGAGGAGCATTGAACTTTGGGGGACTTGGCAAAGGCTTGCAGACGCCCGCGCGACTGGATTCCCGCAAATGCACAGAGCTGGTTTGACCTTTA

GGGGAGTTCGAGGGAGGATAGCAGGAATCTCGGGCAGATCGATCTCCTGTCCTTCACTGAGGGAGCCGCCTGGGGTTCTGGTGCGAGTCCTCCTAGGAAA

CCAAGAGGTCCCCGGGCTGCCCCCAGCCCGCGCATCTACACCGCAGCCGCCCCGTGAGCCGCGTTGTTTCTGAGAGTCCTGACCGACTCCTGCCACCGTC

TCCTAAACTTTGACCTGCTCTGGTCCTCCGCCAGGTCCCCGACGCCCGGCTGCCCCCTCCTCCCGCGGTGGACACCAGTAGGGACATGGCTACGGGCTCC

AGGAGAGGAGCGGGCTCTTCTCGGTGCAACCTGGCACCGCCCGCGTAGCATCCTCCACGCTGACCTCCTGCGCTGCGGCGCCGAGCCTCGGGCGGGAGTC

AAGGCAGTCCTCAGAGGTGTAGGAGGCGACAACAACTGGGGACCCGAGGGTCCCTATGGCCGCTGCTCCAAAGCGGCTGCTGAGCGCTGCGAAGCTCGCC

GGCTGCGCTCAGAGCTCCGAGCGACTCTGAGCTGCTTCGCCGGCGGACATCGCCCTCGCGGGACCGCGGAGGGTCAAAGACCCGAGAAGCAGAGACGGTG

GTGGCAGCTGATCTTCCCTCCCACAGGGCGATGTGGCCGGCCGGTGCGGGCACCAAGCTGCCCTGTCCCCGGGACTCCGCGCTCCGGCGGGCGGCGTTCT

CTGGTAATCTCACCGCCCTTCCTTCTCACCTGGTACCCGCCGGTCGCAGCGTCCGGGTCTTCATCAGCGCCAACCCTGAAG CAAACCTCTGACCTAATT

GAAGAAAAACAAAACAAAACAAAAAGTTCACATTCAAATAATCACTGAAGAGTTTGATCCATTAAACATCCAAAGCTCTATTTTGTTGCTGTAAAAGGAC

AGAAAAG - UNI33721 - ATACAGGAGCGGAACGGCAGGCACTAAGAGAAACTGTGTATCCGAAACTGAGAGAATTCTGCAGAGAAAACTATGGGTT

GGAATTTCAG GTCATAGATCTGTACTGGGGAATTGAGGAAGATGAATGGGACAGCCCCGAACTGCAGAAGATGCGCATGAAGCTGCTGGAGGAATGCTT

GAAAACTTCTGCAGGTCCATGCTTTGTT GGCCTCTTAGGTGAAAAATATGGGAACATTCGAATCCCTGGGGAAGTAGAAGCTTCAGAGTTTGAAATGAT

TTTGGATGCTGCTGTCGAGGCAAAATTAGAGACCAAGTTACTGGAAGATTGGTACTGTCGGGATGAGAACTCTGTGCCAGCAGCCTATTACCTCAGACCC

AGGCTGGAGGTGCCAAGAAGCAACAAAAACTCA ACACAGCCTTCTGCCAGTAGTGAACAGGAGAGGCCATGGCAAGAAATATCGGATGAAATCAAAACG

ATATTTAAAGCTGCTGTCAAACTGCTGCATGAACAGGGGAAAATGAAGCAAAGTCAGGCTAAGAGGTACCTGTTCTCAG CTATCGAGGATGAGTTTGAC

TTTGCTCTAGGCAAGCAAACTCCAGCCTTCCTGAAGAAGTGTGTTTGCTACATCAGAAAGATTGCTAACATCGAACGCTTCGTGAAAATCCCAGAGATGG

GGAAATACATGGACATAACCGGAACAGACCCAAGAATCGTCCGTGACCCAGAAGCTCAAGAGAAGCTGATAAAACTCAGGGATGAATTCATTCCTACCAT

TGTTGCATCCTCTAATTTGAGAGTGTACACATCTGTCACTCACTGTGACATGAAACTGGGCTATTCCCAAGAGATAGAAAACCATTACATAGAAGGACTT

GGTAAGCAATTTTATGAAGACATGATTGATATAATTCAGGCAACAGTACAGCAGAACTTTGACACGGAGACTGATACGCTGTACGATGAAATCCTGCAGC

ACTCCTCACTGTGTAAAACATATGCCTCCTTCTATGAATACAAATGTGAATCACTAAACATCTTGCATAAATACATCCTTCCAAGCAAAACCGGGCATAT

CAACCCTCTCGTTGTGTATGGGGGACCATGCACTGGGAAGACTCTACTGCTAGCTGAAGTAGCAAAAAAGGTAAAAATAAATAAATAA
Translation
  - UNI33721 -  MRMKLLEECLKTSAGPCFV GLLGEKYGNIRIPGEVEASEFEMILDAAVEAKLETKLLEDWYCRDENSVPAAYYLRPRLEVPRS

NKNS TQPSASSEQERPWQEISDEIKTIFKAAVKLLHEQGKMKQSQAKRYLFSA AIEDEFDFALGKQTPAFLKKCVCYIRKIANIERFVKIPEMGKYMD

ITGTDPRIVRDPEAQEKLIKLRDEFIPTIVASSNLRVYTSVTHCDMKLGYSQEIENHYIEGLGKQFYEDMIDIIQATVQQNFDTETDTLYDEILQHSSLC

KTYASFYEYKCESLNILHKYILPSKTGHINPLVVYGGPCTGKTLLLAEVAKKVKINK
Transcript ENSMUST00000113839
Sequence
GATACAGGAGCGGAACGGCAGGCACTAAGAGAAACTGTGTATCCGAAACTGAGAGAATTCTGCAGAGAAAACTATGGGTTGGAATTTCAG GTCATAGAT

CTGTACTGGGGAATTGAGGAAGATGAATGGGACAGCCCCGAACTGCAGAAGATGCGCATGAAGCTGCTGGAGGAATGCTTGAAAACTTCTGCAGGTCCAT

GCTTTGTT GGACTATTGTTA
Translation
DTGAERQALRETVYPKLREFCRENYGLEFQ VIDLYWGIEEDEWDSPELQKMRMKLLEECLKTSAGPCFV GLLL

For any suggestions or comments, please send an email to unitrap@crg.es