Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000079511 (Ccdc142)
Chromosomal location
Chr 6: 83051611 - 83059931 (+)
Description
coiled-coil domain containing 142 Gene [Source:MGI Symbol;Acc:MGI:3045292]
RefSeq_dna
NM_001081266 
RefSeq_peptide
NP_001074735.1 
UniGene
Mm.436553 
MGI
MGI:3045292 
Uniprot/SWISSPROT
Q8CAI1 
Human Ortholog
ENSG00000135637 (CCDC142)
Omim not available
UniTrap UNI30609
Vector Insertion
Chr 6: 83058084 - 83058372
Public Clones IST11724D4 (tigm) IST12445F11BBF1 (tigm) IST13944F1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 87% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000101254
Sequence
GGGCGTGGAGTGCGACGGGAAGCGGGGAGGCGGCGAGCGTTAGGTTCGTTTGGGACTCGCCGTGCAAATGGCACGGGCGTCCAGCTCTAGTGGCCCTTTG

CCTCCACTCGCTAACGTACCCTCGTCGTGGGCGCAGCCCGTGGGCGCTGGGGAGGAGCGGGACGAGGGGAGGCGTGGAGGGCTAGGGCTACTGGCTGCGG

TGAGCGTCCCGTGCCCGGACTTCAGCAGACAGCCGTGGGCTCCCGCGTCTGCAAGCGGCCCGATGCCCTTCGCTCTTCAGCGGCTCCGGGCCACATTGCT

TCGTCTGCACCGCGAGCGAGAGCAGCTCCTGCGGGCCCGGGACTGCGCCCGCCACCTGCAGGCGGTCGTGCGGCTGCTCCGCTCCGGCTCCTCGGCCGGT

TCCCTCTCCCTGCAGCAGTTGCACGGCGATTTACAGCTGTGCCCATCTCGTGGGGCGGCTCTGCGCCTCGGCTTCCCGGGCTCCAGGGAGACGCTTCTCC

TGACTCGCCCTGTCGGGCTAGCTGCCCAGCACTTGGAGGCTGCCATCGAGATGCAGCTTCGTTCACTGGGCCGGACACCCGCTAGCCTGGGCCTGACATC

CCAGCTAGCCGAACTGTTGCTGGCCCTTCCCTTCTACCACACTCTGCAGGGACATTCCCTGAACTTCGTCCCCGGGGCCGCGCGCCCATTCCCCGCGGCC

CGTGTGCTCCAGCTCCTGGCTGCAGAGCGGGGTTGTCAGGTGGCAGATAAGCTGGCTGAAGCCCGTGGCGGATCGGGCTTGCAGGAGCAGCTCCGTCGGC

AGTGCGAGCAAGAGCGAGAGCTGCTGCCCGGGCTGCTGGGCCTGGTAGGGGGCGTGGCTAGCACCGACAGCAGCGGACTGAGGCTTGGGGGACCTGGAGC

CCTGTGGAGCCAGTATTGGACCTTGCTGTGGGCAGCCTGTGCTAAGTGTTTGGACCTACGCGTGGGACCCTGGGAGGACCCTAGAGCAATGGCACAAGAG

CTGAGTCAGGCACTGTGTCAAG CACCCCTGCCTCAGGAGTGTGAGAAGGAGCTGTTGTCTCTGTGTCACAGCCTGTTTCACCAGTCTGTCATCTGCAGC

TGGGACCAAG GGTTCTGCCAGGCCTTAGGATCAGCCCTGGGTGGTCAGAGCAGCCCTGCGTCACTGTCTCCTACCTCTGAGCTGCTGCAGCGGCTTTTT

CCTCCCCTCTTGGATAGCCTTCGACAGCCCAGGCCAGAACTTAGGCTGTGTCCGCCTGCAG GTCCTACGCCTGTCGCTCTGGGGCTCTGTACCCTGCAG

ACCACCTTGCTCTGGTTTGTGGGCAGAGCTCAGCAGCACCTGGCAGCGTGGGACCCCGGTTCCTTCTTGCTCCTGCTCCAGAAGGATCTGCCT CCTCTT

CTGTCTGCGGTGGAGGCGCTGTCCAGCCTGGCCTCCGAAGCAGCGCTCACTCTGGAGGTGGAGCAGCAGCTGGGCCTAGAGATCCACAATTTGACTGAAA

AGATGCAG CTCCTGCCCAAAGAATCACTGGGTCTGTTTGTCCAAGAATGCCATAAACAAGCCACACAAGGCTTCAAGCTCCACATGCCGAGGGGTCGAT

ACTGGAGACTTCGATTGTGTCCTG AACCTCCCAGTGACCCTAGTGAGTACGCTCGGATAGTGGTCTACTCTGTGTTGGAGCCTGTGTTGCAAGGACTTC

AGGGATTGCCACCTGAAGCCCAAGCCCCTGCCCTCGGCCAGGCACTGACAGCCACACTGGGCGCCTGGCTTGACCACATCCTCACCCATGGGATCCGGTT

CAG CCTGCAGGGGGCGCTGCAGCTCAAGCAAGACTTCGGAGTGGTCAGGGAGGTTCTGGAACAAGAGCAGTGGGGCCTGTCGCAGGAGCTTCGCCAGAC

TCTGCTCTCACTCAGCATCTTCCAGCAGCTAGATGGGGCCCTGCTGTGTCTCCTGCAGCAACCCCTGCCCAAGAATCCAGTCCACAGAAGACCTCCCCGT

TGCT - UNI30609 - GTCTCTGTTATGAGGTCCAGACCACTGAACTGCCCACCAGCAGCCTCAACAGCCTGGAAAACTTGGCACCCCCTCTTCGTCT

TGGAGTCTCCCCTGCCCAGAACACTCACCTGCTAAGCACCCTGGGGGGAGGAGGACGAGGAGGAGGGGGAGGGGGAGGACCAGGACCTAGTCCTGAGGCT

TACCTGGTGGGAAACCAGCAAGCCTGGCTTGCCCTGAGGCTGCACCAACACCCACGTTGGCACCTGCCTTTTTTTTCTTGCCTGAGGACAAGTCCTGAAC

CCTAA
Translation
MARASSSSGPLPPLANVPSSWAQPVGAGEERDEGRRGGLGLLAAVSVPCPDFSRQPWAPASASGPMPFALQRLRATLLRLHREREQLLRARDCARHLQAV

VRLLRSGSSAGSLSLQQLHGDLQLCPSRGAALRLGFPGSRETLLLTRPVGLAAQHLEAAIEMQLRSLGRTPASLGLTSQLAELLLALPFYHTLQGHSLNF

VPGAARPFPAARVLQLLAAERGCQVADKLAEARGGSGLQEQLRRQCEQERELLPGLLGLVGGVASTDSSGLRLGGPGALWSQYWTLLWAACAKCLDLRVG

PWEDPRAMAQELSQALCQA APLPQECEKELLSLCHSLFHQSVICSWDQG GFCQALGSALGGQSSPASLSPTSELLQRLFPPLLDSLRQPRPELRLCPP

AG GPTPVALGLCTLQTTLLWFVGRAQQHLAAWDPGSFLLLLQKDLP PLLSAVEALSSLASEAALTLEVEQQLGLEIHNLTEKMQ LLPKESLGLFVQE

CHKQATQGFKLHMPRGRYWRLRLCPE EPPSDPSEYARIVVYSVLEPVLQGLQGLPPEAQAPALGQALTATLGAWLDHILTHGIRFS SLQGALQLKQDF

GVVREVLEQEQWGLSQELRQTLLSLSIFQQLDGALLCLLQQPLPKNPVHRRPPRCC - UNI30609 - CLCYEVQTTELPTSSLNSLENLAPPLRLGV

SPAQNTHLLSTLGGGGRGGGGGGGPGPSPEAYLVGNQQAWLALRLHQHPRWHLPFFSCLRTSPEP
Transcript ENSMUST00000101253
Sequence
GGGCGTGGAGTGCGACGGGAAGCGGGGAGGCGGCGAGCGTTAGGTTCGTTTGGGACTCGCCGTGCAAATGGCACGGGCGTCCAGCTCTAGTGGCCCTTTG

CCTCCACTCGCTAACGTACCCTCGTCGTGGGCGCAGCCCGTGGGCGCTGGGGAGGAGCGGGACGAGGGGAGGCGTGGAGGGCTAGGGCTACTGGCTGCGG

TGAGCGTCCCGTGCCCGGACTTCAGCAGACAGCCGTGGGCTCCCGCGTCTGCAAGCGGCCCGATGCCCTTCGCTCTTCAGCGGCTCCGGGCCACATTGCT

TCGTCTGCACCGCGAGCGAGAGCAGCTCCTGCGGGCCCGGGACTGCGCCCGCCACCTGCAGGCGGTCGTGCGGCTGCTCCGCTCCGGCTCCTCGGCCGGT

TCCCTCTCCCTGCAGCAGTTGCACGGCGATTTACAGCTGTGCCCATCTCGTGGGGCGGCTCTGCGCCTCGGCTTCCCGGGCTCCAGGGAGACGCTTCTCC

TGACTCGCCCTGTCGGGCTAGCTGCCCAGCACTTGGAGGCTGCCATCGAGATGCAGCTTCGTTCACTGGGCCGGACACCCGCTAGCCTGGGCCTGACATC

CCAGCTAGCCGAACTGTTGCTGGCCCTTCCCTTCTACCACACTCTGCAGGGACATTCCCTGAACTTCGTCCCCGGGGCCGCGCGCCCATTCCCCGCGGCC

CGTGTGCTCCAGCTCCTGGCTGCAGAGCGGGGTTGTCAGGTGGCAGATAAGCTGGCTGAAGCCCGTGGCGGATCGGGCTTGCAGGAGCAGCTCCGTCGGC

AGTGCGAGCAAGAGCGAGAGCTGCTGCCCGGGCTGCTGGGCCTGGTAGGGGGCGTGGCTAGCACCGACAGCAGCGGACTGAGGCTTGGGGGACCTGGAGC

CCTGTGGAGCCAGTATTGGACCTTGCTGTGGGCAGCCTGTGCTAAGTGTTTGGACCTACGCGTGGGACCCTGGGAGGACCCTAGAGCAATGGCACAAGAG

CTGAGTCAGGCACTGTGTCAAG CACCCCTGCCTCAGGAGTGTGAGAAGGAGCTGTTGTCTCTGTGTCACAGCCTGTTTCACCAGTCTGTCATCTGCAGC

TGGGACCAAG GGTTCTGCCAGGCCTTAGGATCAGCCCTGGGTGGTCAGAGCAGCCCTGCGTCACTGTCTCCTACCTCTGAGCTGCTGCAGCGGCTTTTT

CCTCCCCTCTTGGATAGCCTTCGACAGCCCAGGCCAGAACTTAGGCTGTGTCCGCCTGCAG GTCCTACGCCTGTCGCTCTGGGGCTCTGTACCCTGCAG

ACCACCTTGCTCTGGTTTGTGGGCAGAGCTCAGCAGCACCTGGCAGCGTGGGACCCCGGTTCCTTCTTGCTCCTGCTCCAGAAGGATCTGCCT CCTCTT

CTGTCTGCGGTGGAGGCGCTGTCCAGCCTGGCCTCCGAAGCAGCGCTCACTCTGGAGGTGGAGCAGCAGCTGGGCCTAGAGATCCACAATTTGACTGAAA

AGATGCAG CTCCTGCCCAAAGAATCACTGGGTCTGTTTGTCCAAGAATGCCATAAACAAGCCACACAAGGCTTCAAGCTCCACATGCCGAGGGGTCGAT

ACTGGAGACTTCGATTGTGTCCTG AACCTCCCAGTGACCCTAGTGAGTACGCTCGGATAGTGGTCTACTCTGTGTTGGAGCCTGTGTTGCAAGGACTTC

AGGGATTGCCACCTGAAGCCCAAGCCCCTGCCCTCGGCCAGGCACTGACAGCCACACTGGGCGCCTGGCTTGACCACATCCTCACCCATGGGATCCGGTT

CAG CCTGCAGGGGGCGCTGCAGCTCAAGCAAGACTTCGGAGTGGTCAGGGAGGTTCTGGAACAAGAGCAGTGGGGCCTGTCGCAGGAGCTTCGCCAGAC

TCTGCTCTCACTCAGCATCTTCCAGCAGCTAGATGGGGCCCTGCTGTGTCTCCTGCAGCAACCCCTGCCCAAGAATCCAGTCCACAGAAGACCTCCCCGT

TGCT - UNI30609 - GTCTCTGTTATGAGGTCCAGACCACTGAACTGCCCACCAGCAGCCTCAACAGCCTGGAAAACTTGGCACCCCCTCTTCGTCT

TGGAGTCTCCCCTGCCCAGAACACTCACCTGCTAAGCACCCTGGGGGGAGGAGGACGAGGAGGAGGGGGAGGGGGAGGACCAGGACCTAGTCCTGAGGCT

TACCTGGTGGGAAACCAGCAAGCCTGGCTTGCCCTGAGGCTGCACCAACACCCACGTTGGCACCTGCCTTTTTTTTCTTGCCTGAGGACAAGTCCTGAAC

CCTAAGTTGACTAGGACCAGGGGTTGCAGATCATGCCCCAGACAAGGAACTGTATGCTAGAGAAGCTTAAACCTGGGTGCTTGATAAAACATGTTCATAA

ACTAGAGTCCAGAATTGAACCCCCAGATCATCCTAGGATCTGCAATCCAGAGTAATAGGCAAACTACAGCCTGAAATCTGGATGTCGGAAACAATGAAGA

CATCTTGGAGCTAAAACTAGAAGGGGTCTACAGGGCTAGCGCTCAGGAGACAGGCAAACCTTGCTTTCTCTCGAATCCCAGGAGCAAAGCGAAAACTGAT

TCATGAGGAAACACAGACAAAGCAGACATTTCTACACGTGGAGGGCAGTCTTACCCCTTCCCCGTCTCTGTTTCTAGTCATTAGGCTGTAGGGCCTGGAC

ATTTAAGCCTTGGCTGTTGCTACAGGGGCAGGGCTTGCCTTCTGCTGGGTGGACAGTCCCCGCAGTGACATCCTTTCCAAGGAAGGAGCCAGGATGTGGG

GTGGTGCTGACCTAGATCTCGCAGGCAGGACCCCGAGGGAGAGGGCTGAAGGACGTTTTCCTGCGAAGGGGATTTTGCACATTCACTGCTTATGCTGTGT

GGCACAGAACACTGCTAATGGCTGAAGTATTCGCGGGTGGCCCCGGAGGTCAGCCGCGCGAAGTACCGCGGAGCCGCCGGAAGCGGTCCGTTCCAATAAA

CCGATCCCCAGTGCTACTCCTTCCGGGGTGGAGGTAACCATGGCGGCGGCTTTGGCTCGGCTCGGACTACGGCCGGTCAAGCTGGTTCGAGTTCAGTTCT

GCCCGTTTGAGAAGAACGTGGAGTCCACGAG GACCTTCCTCCAGACGGTGAGCAGCGAGAAAGTCCGCGCCACCAACCTCAACTGCTCTGTGATCGCCG

ACGTGAGGCACGACGGCTCTGAGCCCTGCGTGGACGTGTTGTTCG GAGATGGGTATCGGCTGATTATGCGCGGTGCCCACCTCACCACTCAGGAAATGT

TAAGTGCCTTGGCCTCCCACATCCGGGACAGGAACGCCGCGGCAGCATCTGCACCGGGCGCAGACAAGGTCGCCCCGGGTACGAGTACCCGCCGCTGATA

TGGCAGAAGAGTCCAACAACCAAATGTTAGCTTGAATCTAAAGACAGTGAGTGGTCTGAGAAGACCTGGGCTTTAATCACTCAAAATGCTGCATGGAGCT

CATGATACGGAGCAAGAACACTAACAACAGGGCTTCTGGGGCAAGATAAGTAAGTTTGGGTGGTGAAGGGCCCCGACAAATTGGAATTTTTCTTTCTCAG

TGTTTAACTTTATTTGGATCTGTCAACCAAGTACATTTTAATTAAATATTTATTGCCAAATG
Translation
MARASSSSGPLPPLANVPSSWAQPVGAGEERDEGRRGGLGLLAAVSVPCPDFSRQPWAPASASGPMPFALQRLRATLLRLHREREQLLRARDCARHLQAV

VRLLRSGSSAGSLSLQQLHGDLQLCPSRGAALRLGFPGSRETLLLTRPVGLAAQHLEAAIEMQLRSLGRTPASLGLTSQLAELLLALPFYHTLQGHSLNF

VPGAARPFPAARVLQLLAAERGCQVADKLAEARGGSGLQEQLRRQCEQERELLPGLLGLVGGVASTDSSGLRLGGPGALWSQYWTLLWAACAKCLDLRVG

PWEDPRAMAQELSQALCQA APLPQECEKELLSLCHSLFHQSVICSWDQG GFCQALGSALGGQSSPASLSPTSELLQRLFPPLLDSLRQPRPELRLCPP

AG GPTPVALGLCTLQTTLLWFVGRAQQHLAAWDPGSFLLLLQKDLP PLLSAVEALSSLASEAALTLEVEQQLGLEIHNLTEKMQ LLPKESLGLFVQE

CHKQATQGFKLHMPRGRYWRLRLCPE EPPSDPSEYARIVVYSVLEPVLQGLQGLPPEAQAPALGQALTATLGAWLDHILTHGIRFS SLQGALQLKQDF

GVVREVLEQEQWGLSQELRQTLLSLSIFQQLDGALLCLLQQPLPKNPVHRRPPRCC - UNI30609 - CLCYEVQTTELPTSSLNSLENLAPPLRLGV

SPAQNTHLLSTLGGGGRGGGGGGGPGPSPEAYLVGNQQAWLALRLHQHPRWHLPFFSCLRTSPEP  

For any suggestions or comments, please send an email to unitrap@crg.es