Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000079518 (BX284111.7)
Chromosomal location
Chr X: 75715283 - 75829194 (-)
Description
not available
Human Ortholog
ENSG00000219186 (AJ239329.2)
Omim not available
UniTrap UNI30603
Vector Insertion
Chr X: 75715282 - 75727801
Public Clones IST12760H1BBF1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000114024
Sequence
CTCTTTGCTCCTGGCTCCGGCTCTAGCGGGTGCGCGCAGGCGCGGCTTGCAGCTCTGCTAGCGCGTAGTAGCTGAGCGGGGCTCACG AGAATCATCATT

CAAGACCTGTCAGAAGCTACAAGCGAAAAATGGGAAGGG GTTCCTGAAAAAACTGCTTTGAGAAGGACGCTGTGTCGTAGCTCTTTTCTGCTGGTTGGA

GACAGAAGCGACAAATGGTGGCTCGTACGGGGATGTTCAGAACTCATTGCAGTCAGGGCAGCTAGCTGGTAAGTTCCCAG CTTCTTCTGTGTGGCCTGA

TGTTAAAATTCCAATGAGGATTCTATCAACAGGCAACTAAAAAAATAAAA TTTTCCTCACGGAAGAAAAAGCCAACTCAGTACTAAAACGCTACCCAAG

AGCCAATGGGCTTTTTGAAGAAATAAGACAGGGCAACATTGAGCGTGAGTGCAGAGAAGAAATCTGTACATATGAAGAAGCCAGAGAGGCTTTTGAAAAT

CATGAAAAAACT - UNI30603 - TTTGCACTCCTTCCCAAATAATCTGCTCTTGCCATG - UNI30603 - CTTCCACCACTGCCGCTGCCACCA

TTACTTCCTTCCTGTGCTACACCTCAGACAAGCCAGGGGCCTTCATTCTCAGGTTAACCCAACACCTGAAATGGAATTTCAACGCAGGCGAGGTCAACAC

CAGCACCACTGGTGCCCTCTCCACACTTCCCGAGTGAGTATGGCCTACCCACTGCTGATCTTGCCAGCCACCCTGACTGCAACTTTATCCTCTCAAGTGA

TGCAAAACAACCATCCTGACTGCGAGGTGCCATCAACAGCCACATCCAGTCCTAGCTCTATGTCTCCTACATCTACCTGTCCATGGCTGCCTTCTGTGAC

TTCGGAGGTTTGAACCAAAAACATTTCACCCGCTTCTTCCTGAGTAAGTCTCATGAATGGTGGACATTTACTGAACTTTTCCTAACACTTCAGAATGAGC

AAGGAGGCCACATCTCCTTCTGTGACATTGAGAAGCCAGACAGTGATGAATGGGTTAATGGCCTCGCATCCATGGAATGTGCCTTCCACCTAGAGATGAC

TGTCAATGACAGTTTCCAGGACTTGTATCTGCCTGCTTTTAGCAAAGGGGATGCTCATCTTTGCAGCTTCCTGAAGCACCAGTGTCTGAAGCCTCATTTG

AAAGACATCCAGAAGATGTTTGTCTTTCTGGCCAACATGCTCCAGGTAGAGGCTGGGAAAGATGATGTTATCGAGTATCTTTTCAGTAAGCTTCACCTGG

ATAGCAGCAGCTCAAAGAATTGACTGTTGACTGGTGATTGTTGCTGGGTCACTATACTGAGACCTGTATTGCCCTCAGAGCAAGTTCACTAGTTTTTCAG

TTTCAACTGTTTTATATAAAGTTCTTTTGTTCTCAGC
Translation
     - UNI30603 -  - UNI30603 - YLSMAAFCDFGGLNQKHFTRFFLSKSHEWWTFTELFLTLQNEQGGHISFCDIEKPDSDEWVNGLASME

CAFHLEMTVNDSFQDLYLPAFSKGDAHLCSFLKHQCLKPHLKDIQKMFVFLANMLQVEAGKDDVIEYLFSKLHLDSSSSKN

For any suggestions or comments, please send an email to unitrap@crg.es