Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000079563 (Pglyrp2)
Chromosomal location
Chr 17: 32550306 - 32561112 (-)
Description
peptidoglycan recognition protein 2 Gene [Source:MGI Symbol;Acc:MGI:1928099]
Human Ortholog
not available
Omim not available
UniTrap UNI36832
Vector Insertion
Chr 17: 32557744 - 32561113
Public Clones IST14642D4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000114454
Sequence
TGAGGGCAAGTGGGAGGAAGTCACTCAAAGGTACCCTGAGCCTTCGTTCCCCCATTCTTGCATCTCCGTTATGTGAGGTAAGCAGCTTTCTCCAACAGAA

GTTCCTCTCTCCTCAAAGGCCCAGAGTGTCCAGGCCAACCAACTGACCAAGAATTACAACTGCTGAAACT - UNI36832 - GGCCTCCGAGGTTCTC

TGCTGGGTCTGTGCCCTGGAACTGGAGACCCACCATGAAGGCCTGGGGTGCCCTCTGGATCGTGCTTGGATTGCTGCTGTGGCCAGAGCCAGGGGCAG -

 UNI36832 - CCTCCTCCTTGCCTCTGCTCATGGACTCCATCATCCAGGCCCTTGCTGAACTTGAGCAAAAGGTACCAGTGACTGAGGCCAGCATCAC

TGCCTCTGCATGGATTCTGTCAGCCAAGAACTCCAGCACCCACAATTCCCTTCACCAGCGCTTGCTGCTGAAGGCACCAAGCCACAACACTACAGAGCCA

GATCCTCACTCTCTCAGCCCGGAGCTTCAAGCACTGATTTCTGAGGTGGCTCAACACGATGTACAGAATGGGCGGGAATATGGAGTGGTGCTGGCACCTG

ATGGCTCCACCGTAGCTGTGAAGCCTCTGCTGTTTGGGCTAGAGGCCGGTCTACAGGCACACAGCGTTGCTAACTTGCCTTCAGATTGTCTGGCTATCCC

CTGTGATACTGGAGACACCTTGGCCAATATTAGAGCCACCTGGCCAGGACTCATGGATGCTTTTCCAAATGCCTCTTCTCCAGATGTTGGAGCCACTTTA

CCAAACGACAAAGCCAAGACTCCCACCACTGTGGACAGACTCCTGGCAATCACCTTGGCTGGTGACTTAGGTCTGACCTTCCTCCACAGGTCCCAGACTT

GGAGTCCTCCAGGACTGGGAACTGAGGGCTGCTGGGACCAGCTTACTGCCCCCAGGGTCTTCACACTGTTGGACCCCCAGGCATCCAGGCTCACCATGGC

TTTCCTCAATGGTGCCTTAGATGGAGCTCTCCTTGGGAACCACTTGAGCCAAATCCCTAGGCCCCACCCACCCCTCAGCCACCTGCTAAGAGAGTACTAT

GGAGCTGGGGTGAATGGAGATCCGGTGTTCCGAAGTAACTTCCGAAGGCAGAACGGTGCTGCTTTGACTTCAGCCCCTACCCTGGCCCAGCAG TTTCGT

GGTAGGCTCCGACGGCTATCTGTACCAGGGCCGTGGCTGGCACTGGGTAGGTGCGCACACACGCGGCTACAACTCCCGCGGCTTCGGTGTGGCCTTCGTG

GGCAACTACACTGGGTCACTGCCCAACGAAGCTGCGCTGAACACGGTGCGCGACGCGCTCCCGAGCTGCGCAATTCGCGCAGGTCTCTTGCGGCCAGACT

ACAAGCTGCTTGGCCACCGCCAGCTAGTGCTCACCCACTGCCCCGGGAACGCGCTCTTCAACTTGCTGCGCACCTGGCCTCACTTCACAGAG GTTGAAA

ACTAAGAACTCCTTTGAGAGACCCTTGAAGATCCAGGAGGTATTATCCCTGATGATCCTTTGAGCAACCACAGACCTCCAATAAAGGGACCACTGAAAGG

AAATCTC
Translation
 - UNI36832 - MKAWGALWIVLGLLLWPEPGAA - UNI36832 - ASSLPLLMDSIIQALAELEQKVPVTEASITASAWILSAKNSSTHNSLHQR

LLLKAPSHNTTEPDPHSLSPELQALISEVAQHDVQNGREYGVVLAPDGSTVAVKPLLFGLEAGLQAHSVANLPSDCLAIPCDTGDTLANIRATWPGLMDA

FPNASSPDVGATLPNDKAKTPTTVDRLLAITLAGDLGLTFLHRSQTWSPPGLGTEGCWDQLTAPRVFTLLDPQASRLTMAFLNGALDGALLGNHLSQIPR

PHPPLSHLLREYYGAGVNGDPVFRSNFRRQNGAALTSAPTLAQQ FRGRLRRLSVPGPWLALGRCAHTRLQLPRLRCGLRGQLHWVTAQRSCAEHGARRA

PELRNSRRSLAARLQAAWPPPASAHPLPRERALQLAAHLASLHRG G
Transcript ENSMUST00000114455
Sequence
TGAGGGCAAGTGGGAGGAAGTCACTCAAAGGTACCCTGAGCCTTCGTTCCCCCATTCTTGCATCTCCGTTATGTGAGGTAAGCAGCTTTCTCCAACAGAA

GTTCCTCTCTCCTCAAAGGCCCAGAGTGTCCAGGCCAACCAACTGACCAAGAATTACAACTGCTGAAACT - UNI36832 - GGCCTCCGAGGTTCTC

TGCTGGGTCTGTGCCCTGGAACTGGAGACCCACCATGAAGGCCTGGGGTGCCCTCTGGATCGTGCTTGGATTGCTGCTGTGGCCAGAGCCAGGGGCAG -

 UNI36832 - CCTCCTCCTTGCCTCTGCTCATGGACTCCATCATCCAGGCCCTTGCTGAACTTGAGCAAAAGGTACCAGTGACTGAGGCCAGCATCAC

TGCCTCTGCATGGATTCTGTCAGCCAAGAACTCCAGCACCCACAATTCCCTTCACCAGCGCTTGCTGCTGAAGGCACCAAGCCACAACACTACAGAGCCA

GATCCTCACTCTCTCAGCCCGGAGCTTCAAGCACTGATTTCTGAGGTGGCTCAACACGATGTACAGAATGGGCGGGAATATGGAGTGGTGCTGGCACCTG

ATGGCTCCACCGTAGCTGTGAAGCCTCTGCTGTTTGGGCTAGAGGCCGGTCTACAGGCACACAGCGTTGCTAACTTGCCTTCAGATTGTCTGGCTATCCC

CTGTGATACTGGAGACACCTTGGCCAATATTAGAGCCACCTGGCCAGGACTCATGGATGCTTTTCCAAATGCCTCTTCTCCAGATGTTGGAGCCACTTTA

CCAAACGACAAAGCCAAGACTCCCACCACTGTGGACAGACTCCTGGCAATCACCTTGGCTGGTGACTTAGGTCTGACCTTCCTCCACAGGTCCCAGACTT

GGAGTCCTCCAGGACTGGGAACTGAGGGCTGCTGGGACCAGCTTACTGCCCCCAGGGTCTTCACACTGTTGGACCCCCAGGCATCCAGGCTCACCATGGC

TTTCCTCAATGGTGCCTTAGATGGAGCTCTCCTTGGGAACCACTTGAGCCAAATCCCTAGGCCCCACCCACCCCTCAGCCACCTGCTAAGAGAGTACTAT

GGAGCTGGGGTGAATGGAGATCCGGTGTTCCGAAGTAACTTCCGAAGGCAGAACGGTGCTGCTTTGACTTCAGCCCCTACCCTGGCCCAGCAGGTATGGG

AGGCCCTTGTCCTGTTACAGAAACTGGAGCCAGAACACCTACAGTTGCAGAACATTAGCCAAGAGCAGCTGGCTCAGGTAGCCACCTTGGCTACCAAGGA

GTTCACTGAGGCTTTCCTGG GATGCCCAGCCATTCACCCCCGCTGCCGTTGGGGAGCGGCTCCCTACCGAGGCCACCCAACACCACTCCGGCTGCCACT

TGGATTCTTATATGTGCATCACACATACGTGCCAGCGCCACCCTGCACCACCTTCCAGAGCTGCGCCGCCGATATGCGCTCCATGCAGCGTTTCCACCAG

GATGTGCGCAAGTGGGATGACATCGGCTACAG TTTCGTGGTAGGCTCCGACGGCTATCTGTACCAGGGCCGTGGCTGGCACTGGGTAGGTGCGCACACA

CGCGGCTACAACTCCCGCGGCTTCGGTGTGGCCTTCGTGGGCAACTACACTGGGTCACTGCCCAACGAAGCTGCGCTGAACACGGTGCGCGACGCGCTCC

CGAGCTGCGCAATTCGCGCAGGTCTCTTGCGGCCAGACTACAAGCTGCTTGGCCACCGCCAGCTAGTGCTCACCCACTGCCCCGGGAACGCGCTCTTCAA

CTTGCTGCGCACCTGGCCTCACTTCACAGAG GTTGAAAACTAAGAACTCCTTTGAGAGACCCTTGAAGATCCAGGAGGTATTATCCCTGATGATCCTTT

GAGCAACCACAGACCTCCAATAAAGGGACCACTGAAAGGAAATCTC
Translation
 - UNI36832 - MKAWGALWIVLGLLLWPEPGAA - UNI36832 - ASSLPLLMDSIIQALAELEQKVPVTEASITASAWILSAKNSSTHNSLHQR

LLLKAPSHNTTEPDPHSLSPELQALISEVAQHDVQNGREYGVVLAPDGSTVAVKPLLFGLEAGLQAHSVANLPSDCLAIPCDTGDTLANIRATWPGLMDA

FPNASSPDVGATLPNDKAKTPTTVDRLLAITLAGDLGLTFLHRSQTWSPPGLGTEGCWDQLTAPRVFTLLDPQASRLTMAFLNGALDGALLGNHLSQIPR

PHPPLSHLLREYYGAGVNGDPVFRSNFRRQNGAALTSAPTLAQQVWEALVLLQKLEPEHLQLQNISQEQLAQVATLATKEFTEAFLG GCPAIHPRCRWG

AAPYRGHPTPLRLPLGFLYVHHTYVPAPPCTTFQSCAADMRSMQRFHQDVRKWDDIGYS SFVVGSDGYLYQGRGWHWVGAHTRGYNSRGFGVAFVGNYT

GSLPNEAALNTVRDALPSCAIRAGLLRPDYKLLGHRQLVLTHCPGNALFNLLRTWPHFTE VEN
Transcript ENSMUST00000114456
Sequence
TGAGGGCAAGTGGGAGGAAGTCACTCAAAGGTACCCTGAGCCTTCGTTCCCCCATTCTTGCATCTCCGTTATGTGAGGTAAGCAGCTTTCTCCAACAGAA

GTTCCTCTCTCCTCAAAGGCCCAGAGTGTCCAGGCCAACCAACTGACCAAGAATTACAACTGCTGAAACT - UNI36832 - GGCCTCCGAGGTTCTC

TGCTGGGTCTGTGCCCTGGAACTGGAGACCCACCATGAAGGCCTGGGGTGCCCTCTGGATCGTGCTTGGATTGCTGCTGTGGCCAGAGCCAGGGGCAG -

 UNI36832 - CCTCCTCCTTGCCTCTGCTCATGGACTCCATCATCCAGGCCCTTGCTGAACTTGAGCAAAAGGTACCAGTGACTGAGGCCAGCATCAC

TGCCTCTGCATGGATTCTGTCAGCCAAGAACTCCAGCACCCACAATTCCCTTCACCAGCGCTTGCTGCTGAAGGCACCAAGCCACAACACTACAGAGCCA

GATCCTCACTCTCTCAGCCCGGAGCTTCAAGCACTGATTTCTGAGGTGGCTCAACACGATGTACAGAATGGGCGGGAATATGGAGTGGTGCTGGCACCTG

ATGGCTCCACCGTAGCTGTGAAGCCTCTGCTGTTTGGGCTAGAGGCCGGTCTACAGGCACACAGCGTTGCTAACTTGCCTTCAGATTGTCTGGCTATCCC

CTGTGATACTGGAGACACCTTGGCCAATATTAGAGCCACCTGGCCAGGACTCATGGATGCTTTTCCAAATGCCTCTTCTCCAGATGTTGGAGCCACTTTA

CCAAACGACAAAGCCAAGACTCCCACCACTGTGGACAGACTCCTGGCAATCACCTTGGCTGGTGACTTAGGTCTGACCTTCCTCCACAGGTCCCAGACTT

GGAGTCCTCCAGGACTGGGAACTGAGGGCTGCTGGGACCAGCTTACTGCCCCCAGGGTCTTCACACTGTTGGACCCCCAGGCATCCAGGCTCACCATGGC

TTTCCTCAATGGTGCCTTAGATGGAGCTCTCCTTGGGAACCACTTGAGCCAAATCCCTAGGCCCCACCCACCCCTCAGCCACCTGCTAAGAGAGTACTAT

GGAGCTGGGGTGAATGGAGATCCGGTGTTCCGAAGTAACTTCCGAAGGCAGAACGGTGCTGCTTTGACTTCAGCCCCTACCCTGGCCCAGCAGGTATGGG

AGGCCCTTGTCCTGTTACAGAAACTGGAGCCAGAACACCTACAGTTGCAGAACATTAGCCAAGAGCAGCTGGCTCAGGTAGCCACCTTGGCTACCAAGGA

GTTCACTGAGGCTTTCCTGG GATGCCCAGCCATTCACCCCCGCTGCCGTTGGGGAGCGGCTCCCTACCGAGGCCACCCAACACCACTCCGGCTGCCACT

TGGATTCTTATATGTGCATCACACATACGTGCCAGCGCCACCCTGCACCACCTTCCAGAGCTGCGCCGCCGATATGCGCTCCATGCAGCGTTTCCACCAG

GATGTGCGCAAGTGGGATGACATCGGCTACAG GTTGAAAACTAAGAACTCCTTTGAGAGACCCTTGAAGATCCAGGAGGTATTATCCCTGATGATCCTT

TGAGCAACCACAGACCTCCAATAAAGGGACCACTGAAAGGAAATCTC
Translation
 - UNI36832 - MKAWGALWIVLGLLLWPEPGAA - UNI36832 - ASSLPLLMDSIIQALAELEQKVPVTEASITASAWILSAKNSSTHNSLHQR

LLLKAPSHNTTEPDPHSLSPELQALISEVAQHDVQNGREYGVVLAPDGSTVAVKPLLFGLEAGLQAHSVANLPSDCLAIPCDTGDTLANIRATWPGLMDA

FPNASSPDVGATLPNDKAKTPTTVDRLLAITLAGDLGLTFLHRSQTWSPPGLGTEGCWDQLTAPRVFTLLDPQASRLTMAFLNGALDGALLGNHLSQIPR

PHPPLSHLLREYYGAGVNGDPVFRSNFRRQNGAALTSAPTLAQQVWEALVLLQKLEPEHLQLQNISQEQLAQVATLATKEFTEAFLG GCPAIHPRCRWG

AAPYRGHPTPLRLPLGFLYVHHTYVPAPPCTTFQSCAADMRSMQRFHQDVRKWDDIGYR RLKTKNSFERPLKIQEVLSLMIL

For any suggestions or comments, please send an email to unitrap@crg.es