Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000079584 (Gm364)
Chromosomal location
Chr X: 54662353 - 54741829 (+)
Description
gene model 364, (NCBI) Gene [Source:MGI Symbol;Acc:MGI:2685210]
Human Ortholog
not available
Omim not available
UniTrap UNI36618
Vector Insertion
Chr X: 54676554 - 54686385
Public Clones IST11884C10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 42% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000114725
Sequence
AGGATGGTTGTTCCTGAGGCAGGCTTTAAGATGGGTCTCAGTGGTCGCCGTGTGGAAACCAAACTCTGCCCTGGCCTTCACGGGCTGAAGTGGTGGCTGT

TGCTGTGTTTCTTGGCCACTACCTGTGATGCTTTCTTCTTCCCGGGACTGGTTCCTGTCACCTACTGTGAGGAGGGTCATCCCAACTCCTATTGTAAG T

CCTCAATTCAGGTGTATGCTGATAAATTATACTCAGTGGACAGTGTGATGTTCTATGATTATGATAG CTTTGACTTCTGTCAAGATTCACTGAAGAGAA

CACCCTCTGAGACTCTTGGACAAATTCTATTTGGAGAACAAGTAACATCATGTCCCTACAAG TTTTCTTTTAACAAAGACGAAACATGTAGAAAAGTCT

GTGTAAAATCTTATGCTCCAGACAATGAAGATGATATGAACAAGTTGGCCTTTTTGAAGAAAGGGATAAAACAGGATTACCGTCATCACTG GATTGTTG

ATAACACAGGAATAATATGGTGTTATGACACTGAAAATGAAGAACACCATTGCATGTCAGGATTTCCAATAGGATGTTTTAATGCCCCAAGTGACCAAGT

GAAAGGTTCTTGCTTGATTAAT CCCGAATTCAACAAAAATAATAGTTTGTACCTCTTCAACCACCTTGACATTACTATTACATATCACATAGAAAGTGA

TACAACTGTCAAGGTTGCAAAACTGATTAGTTCCAGAGTCGATCCCAAAAG CTATAAACATTTAGATGAAGACCACCTGACTTGCAACGAGCCCCCTAT

GGAAATTCCTGAAGAAGATACAGAGAATTTAAATGTGATCTACACATATTCTGTGAAATTTGAG - UNI36618 - GAGAGTAAAGCTACTGAGTGGT

CCTCGGAAGGGGATTATGATTTGGACAGTACCGCCGAGACCAGCCTTCAGTGGATTAG GCTTGTCAACTCCTTTTTTGTGGTACTTTTCTTGTGTGGAC

TGGTGGTTATCCTCCTCTTAAGGAGTATCTGGAGAGACATTGCCAAATTTAACCGTATAAAAATTTCT GTATATGACCGGAGGCTGTTTGGTTGGAGGT

TGATTCATGGGAATCTATTCAGGCTCCCAGAGCATGGCATGTTGCTGTCCATCCTTCTTGGTCAAGGAACACAAGTTTTCATAATGACATTTCTGTCTTT

AT TTTTGGCTGGCCTTGGCTTTCTTACTCCTGCTGATCAAAATGTTTTAGTGAACTATGGTGTTGTGCTGTGGCTCGCACTGGAAATCCCTGCTGGATA

CATGTCTGCCAAAATGTACAAGA CATTTAAAGGTATAAACTGGAAGATGCATTTTTTGCTGACAACAGTGTTATTTCCTGG AATTGTCTTTGCTGATA

TCTTTATTATGAATCTGATTCTATGGATGGATGGCTCACCAGCTGCTATCTCCTTTTGTACACTGGCAAGCCTCTTTGCACTGTACTTTGGAGTTTCAAC

ACCACTGACGTTTTTAGGAGTGTACTTTGGGAAAAGGGAAAAG TTTGAGTTTCCAGTTTATGCACCAAAACATGAGCATGGGAGTCCCCAAAGGACTTT

CTTTCCAAAATCAACTATTACCATTATACTTGGTAGTCTTTTACCCTTTGGCTGTATTTTTCTGCAACTTTCTTATATTCTAAACCGTATTTG GTCTCC

TCATATGTACTACCTGTTTGCCTTCCTTCTCTTACTCTTCTTAATTTTTATGATTTCCTGTTCAGAAGTTACAGTTCTGCTATGCTATTTTCGGCTGTGC

GCTGAG GATCGTGGTTGGTGGTGGAGAGCCTTTTTGACCAGCAGTTTTACATCTGCTTATATTTTTATATATGTAATTCATTACTTTTTTACCAAACTT

CAAGTCACTAGCATTGGAAGTACTTTTATGTACTTTGGGTATGCATTTATCCTAGTGCTAGCTTTCTTTCTTTTCACAG GGACAATTGGATTTTTTTCT

TGCTTCTTCTTTGTTACTACAATCTACGGTGTGATAAAAGAGGATTAA
Translation
MVVPEAGFKMGLSGRRVETKLCPGLHGLKWWLLLCFLATTCDAFFFPGLVPVTYCEEGHPNSYCK SSIQVYADKLYSVDSVMFYDYDS SFDFCQDSLK

RTPSETLGQILFGEQVTSCPYK FSFNKDETCRKVCVKSYAPDNEDDMNKLAFLKKGIKQDYRHHW WIVDNTGIIWCYDTENEEHHCMSGFPIGCFNAP

SDQVKGSCLIN PEFNKNNSLYLFNHLDITITYHIESDTTVKVAKLISSRVDPKS SYKHLDEDHLTCNEPPMEIPEEDTENLNVIYTYSVKFE - UNI

36618 - ESKATEWSSEGDYDLDSTAETSLQWIR RLVNSFFVVLFLCGLVVILLLRSIWRDIAKFNRIKIS VYDRRLFGWRLIHGNLFRLPEHGMLL

SILLGQGTQVFIMTFLSLF FLAGLGFLTPADQNVLVNYGVVLWLALEIPAGYMSAKMYKT TFKGINWKMHFLLTTVLFPG GIVFADIFIMNLILWMD

GSPAAISFCTLASLFALYFGVSTPLTFLGVYFGKREK FEFPVYAPKHEHGSPQRTFFPKSTITIILGSLLPFGCIFLQLSYILNRIW WSPHMYYLFAF

LLLLFLIFMISCSEVTVLLCYFRLCAE DRGWWWRAFLTSSFTSAYIFIYVIHYFFTKLQVTSIGSTFMYFGYAFILVLAFFLFTG GTIGFFSCFFFVT

TIYGVIKED

For any suggestions or comments, please send an email to unitrap@crg.es