Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000079592 (C1qtnf5)
Chromosomal location
Chr 9: 43915328 - 43917270 (+)
Description
C1q and tumor necrosis factor related protein 5 Gene [Source:MGI (curated);Acc:C1qtnf5-008]
RefSeq_peptide
NP_663588.2 NP_001035721.1 NP_001035722.1 
Uniprot/SWISSPROT
Q8K479 
Uniprot/SPTREMBL
Q4ZJN4 Q8R002 
Human Ortholog
ENSG00000213192 (C1QTNF5)
Omim 605670 - LATE-ONSET RETINAL DEGENERATION  
UniTrap UNI29409
Vector Insertion
Chr 9: 43916377 - 43917270
Public Clones CMHD-GT_441F3-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 30% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000114815
Sequence
AGCCAGCAAGGAGCAACCAGAAGCTAGGAGTCAGTCAGCAAGGACAGGGGCTGCCTG CCTACAGACTACAAGAGAGGTTCCTGGAGTCTGAGCCTCCGG

GGTCACCACCATGAGGCCACTTCTTGCCCTTCTGCTTCTGGGTCTGGTGTCAGGCTCTCCTCCTCTGGACGACAACAAGATCCCCAGCCTGTGTCCCGGG

CAGCCCGGCCTTCCAGGCACACCAGGTCACCATGGCAGCCAAGGCCTGCCTGGCCGTGACGGCCGTGATGGCCGCGACGGTGCACCCGGAGCTCCGGGAG

AGAAAGGCGAGGGCGGGAGACCGG - UNI29409 - GACTACCTGGCCCACGTGGGGAGCCCGGGCCGCGTGGAGAGGCAGGGCCCATGGGGGCTATC

GGGCCTGCGGGGGAGTGCTCGGTACCCCCACGATCAGCCTTCAGTGCCAAGCGATCCGAGAGCCGGGTACCTCCGCCAGCCGACACACCCCTACCTTTCG

ACCGTGTGCTGCTAAATGAGCAGGGCCATTACGACCCCACTACTGGCAAGTTCACCTGCCAAGTGCCTGGCGTCTACTACTTTGCTGTGCACGCCACTGT

CTACCGGGCCAGCTTGCAGTTTGATCTTGTCAAAAACGGGCAGTCCATCGCCTCTTTCTTCCAGTATTTTGGGGGGTGGCCCAAGCCAGCCTCGCTCTCA

GGGGGTGCGATGGTAAGGCTAGAACCTGAGGACCAGGTGTGGGTGCAGGTGGGCGTGGGTGATTACATTGGCATCTATGCCAGCATCAAGACAGACAGTA

CCTTCTCTGGATTTCTCGTCTATTCTGACTGGCACAGCTCCCCAGTCTTCGCTTAAAACACAGTGAACCCGGAGCTGGCACTTGCTCCTCAGTGGAGGGT

GTGACACTAACCCGCGCAGCGCATACCAGGAGGGCTGGCCCCCTGGAATATTGTGAATGACTTAGGAAGAGAGGGAGCCACTTCCAGTCCCACTGCTGGC

AATGAATGGAGACAGGCTGTCTGAGGTCAAGACAGCGTGGAGCAGTGGCTGGGTTTCTGCCCAGGACTTTAGAATGCAGTAGGCTGGCAGCTGTGGGTCC

TGGCCCAGGACTCCAAGGTGGGATGCTCCATTCCTAGTCCTGTGTCCCCTCTAGGTCCCTGACTCCATCTCTGCTGCTCCCAGGGCAGGCCTTTTTCTCA

GAGGTCACTTAATAAACCTAAAATCCTCCCA
Translation
 MRPLLALLLLGLVSGSPPLDDNKIPSLCPGQPGLPGTPGHHGSQGLPGRDGRDGRDGAPGAPGEKGEGGRPG - UNI29409 - GLPGPRGEPGPRG

EAGPMGAIGPAGECSVPPRSAFSAKRSESRVPPPADTPLPFDRVLLNEQGHYDPTTGKFTCQVPGVYYFAVHATVYRASLQFDLVKNGQSIASFFQYFGG

WPKPASLSGGAMVRLEPEDQVWVQVGVGDYIGIYASIKTDSTFSGFLVYSDWHSSPVFA
Transcript ENSMUST00000114816
Sequence
ATTTCCCAGCCCTGGAGTTCTTGGCCTCTGAACAACTGGTTTCCTCTAGGAGTCTGGGAGGAGCGCTGTGAAGCCAGCAAGGAGCAACCAGAAGCTAGGA

 CCTACAGACTACAAGAGAGGTTCCTGGAGTCTGAGCCTCCGGGGTCACCACCATGAGGCCACTTCTTGCCCTTCTGCTTCTGGGTCTGGTGTCAGGCTC

TCCTCCTCTGGACGACAACAAGATCCCCAGCCTGTGTCCCGGGCAGCCCGGCCTTCCAGGCACACCAGGTCACCATGGCAGCCAAGGCCTGCCTGGCCGT

GACGGCCGTGATGGCCGCGACGGTGCACCCGGAGCTCCGGGAGAGAAAGGCGAGGGCGGGAGACCGG - UNI29409 - GACTACCTGGCCCACGTGG

GGAGCCCGGGCCGCGTGGAGAGGCAGGGCCCATGGGGGCTATCGGGCCTGCGGGGGAGTGCTCGGTACCCCCACGATCAGCCTTCAGTGCCAAGCGATCC

GAGAGCCGGGTACCTCCGCCAGCCGACACACCCCTACCTTTCGACCGTGTGCTGCTAAATGAGCAGGGCCATTACGACCCCACTACTGGCAAGTTCACCT

GCCAAGTGCCTGGCGTCTACTACTTTGCTGTGCACGCCACTGTCTACCGGGCCAGCTTGCAGTTTGATCTTGTCAAAAACGGGCAGTCCATCGCCTCTTT

CTTCCAGTATTTTGGGGGGTGGCCCAAGCCAGCCTCGCTCTCAGGGGGTGCGATGGTAAGGCTAGAACCTGAGGACCAGGTGTGGGTGCAGGTGGGCGTG

GGTGATTACATTGGCATCTATGCCAGCATCAAGACAGACAGTACCTTCTCTGGATTTCTCGTCTATTCTGACTGGCACAGCTCCCCAGTCTTCGCTTAAA

ACACAGTGAACCCGGAGCTGGCACTTGCTCCTCAGTGGAGGGTGTGACACTAACCCGCGCAGCGCATACCAGGAGGGCTGGCCCCCTGGAATATTGTGAA

TGACTTAGGAAGAGAGGGAGCCACTTCCAGTCCCACTGCTGGCAATGAATGGAGACAGGCTGTCTGAGGTCAAGACAGCGTGGAGCAGTGGCTGGGTTTC

TGCCCAGGACTTTAGAATGCAGTAGGCTGGCAGCTGTGGGTCCTGGCCCAGGACTCCAAGGTGGGATGCTCCATTCCTAGTCCTGTGTCCCCTCTAGGTC

CCTGACTCCATCTCTGCTGCTCCCAGGGCAGGCCTTTTTCTCAGAGGTCACTTAATAAACCTAAAATCCTC
Translation
 MRPLLALLLLGLVSGSPPLDDNKIPSLCPGQPGLPGTPGHHGSQGLPGRDGRDGRDGAPGAPGEKGEGGRPG - UNI29409 - GLPGPRGEPGPRG

EAGPMGAIGPAGECSVPPRSAFSAKRSESRVPPPADTPLPFDRVLLNEQGHYDPTTGKFTCQVPGVYYFAVHATVYRASLQFDLVKNGQSIASFFQYFGG

WPKPASLSGGAMVRLEPEDQVWVQVGVGDYIGIYASIKTDSTFSGFLVYSDWHSSPVFA
Transcript ENSMUST00000114818
Sequence
TTTCCCAGCCCTGGAGTTCTTGGCCTCTGAACAACTGGTTTCCTCTAGGAGTCTGGGAGGAGCGCTGTGAAGCCAGCAAGGAGCAACCAGAAGCTAGGAG

TCAGTCAGCAAGGACAGGGGCTGCCTGGTAGGGGTAGGAGTGGGAGCAGGGCCAGCAGGAAGGTCTGAGGAAGCCATTCAAAGCTTGCAGCTGGGAGTGC

TGGGGAGCCGGGAGGG CCTACAGACTACAAGAGAGGTTCCTGGAGTCTGAGCCTCCGGGGTCACCACCATGAGGCCACTTCTTGCCCTTCTGCTTCTGG

GTCTGGTGTCAGGCTCTCCTCCTCTGGACGACAACAAGATCCCCAGCCTGTGTCCCGGGCAGCCCGGCCTTCCAGGCACACCAGGTCACCATGGCAGCCA

AGGCCTGCCTGGCCGTGACGGCCGTGATGGCCGCGACGGTGCACCCGGAGCTCCGGGAGAGAAAGGCGAGGGCGGGAGACCGG - UNI29409 - GAC

TACCTGGCCCACGTGGGGAGCCCGGGCCGCGTGGAGAGGCAGGGCCCATGGGGGCTATCGGGCCTGCGGGGGAGTGCTCGGTACCCCCACGATCAGCCTT

CAGTGCCAAGCGATCCGAGAGCCGGGTACCTCCGCCAGCCGACACACCCCTACCTTTCGACCGTGTGCTGCTAAATGAGCAGGGCCATTACGACCCCACT

ACTGGCAAGTTCACCTGCCAAGTGCCTGGCGTCTACTACTTTGCTGTGCACGCCACTGTCTACCGGGCCAGCTTGCAGTTTGATCTTGTCAAAAACGGGC

AGTCCATCGCCTCTTTCTTCCAGTATTTTGGGGGGTGGCCCAAGCCAGCCTCGCTCTCAGGGGGTGCGATGGTAAGGCTAGAACCTGAGGACCAGGTGTG

GGTGCAGGTGGGCGTGGGTGATTACATTGGCATCTATGCCAGCATCAAGACAGACAGTACCTTCTCTGGATTTCTCGTCTATTCTGACTGGCACAGCTCC

CCAGTCTTCGCTTAAAACACAGTGAACCCGGAGCTGGCACTTGCTCCTCAGTGGAGGGTGTGACACTAACCCGCGCAGCGCATACCAGGAGGGCTGGCCC

CCTGGAATATTGTGAATGACTTAGGAAGAGAGGGAGCCACTTCCAGTCCCACTGCTGGCAATGAATGGAGACAGGCTGTCTGAGGTCAAGACAGCGTGGA

GCAGTGGCTGGGTTTCTGCCCAGGACTTTAGAATGCAGTAGGCTGGCAGCTGTGGGTCCTGGCCCAGGACTCCAAGGTGGGATGCTCCATTCCTAGTCCT

GTGTCCCCTCTAGGTCCCTGACTCCATCTCTGCTGCTCCCAGGGCAGGCCTTTTTCTCAGAGGTCACTTAATAAACCTAAAATCCTCCC
Translation
 MRPLLALLLLGLVSGSPPLDDNKIPSLCPGQPGLPGTPGHHGSQGLPGRDGRDGRDGAPGAPGEKGEGGRPG - UNI29409 - GLPGPRGEPGPRG

EAGPMGAIGPAGECSVPPRSAFSAKRSESRVPPPADTPLPFDRVLLNEQGHYDPTTGKFTCQVPGVYYFAVHATVYRASLQFDLVKNGQSIASFFQYFGG

WPKPASLSGGAMVRLEPEDQVWVQVGVGDYIGIYASIKTDSTFSGFLVYSDWHSSPVFA

For any suggestions or comments, please send an email to unitrap@crg.es