Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000079614 (Seh1l)
Chromosomal location
Chr 18: 67934530 - 67953250 (+)
Description
SEH1-like (S. cerevisiae Gene [Source:MGI Symbol;Acc:MGI:1919374]
RefSeq_peptide
NP_082388.1 NP_001034177.1 
UniGene
Mm.307315 
MGI
MGI:1919374 
Uniprot/SPTREMBL
Q9D0K7 Q3TLC9 Q3UP79 Q8R2U0 
Human Ortholog
ENSG00000085415 (SEH1L)
Omim not available
UniTrap UNI11425
Vector Insertion
Chr 18: 67934529 - 67934775
Public Clones M120A04 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19256
Vector Insertion
Chr 18: 67934775 - 67938858
Public Clones (sanger) IST14425B1 (tigm) IST14517B7 (tigm) IST14365B12 (tigm) IST14583E3 (tigm)
IST15069A12 (tigm) IST14921A6 (tigm) IST14904D11 (tigm) IST14449F9 (tigm)
IST14130G2 (tigm) IST14470G3 (tigm) IST13606E7 (tigm)
Private Clones OST398480 (lexicon) OST394119 (lexicon) OST296157 (lexicon) OST285151 (lexicon)
OST267443 (lexicon) OST245621 (lexicon) OST240462 (lexicon) OST205105 (lexicon)
OST204649 (lexicon) OST179297 (lexicon) OST167498 (lexicon) OST130617 (lexicon)
OST129331 (lexicon) OST116415 (lexicon) OST65891 (lexicon) OST43122 (lexicon)
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1377
Vector Insertion
Chr 18: 67938910 - 67943568
Public Clones CJ0212 (sanger) XS0301 (sanger) IST10477C12 (tigm)
Private Clones OST449271 (lexicon) OST440954 (lexicon) OST374439 (lexicon) OST322013 (lexicon)
OST302396 (lexicon) OST300242 (lexicon) OST279040 (lexicon) OST250586 (lexicon)
OST249839 (lexicon) OST246109 (lexicon) OST239594 (lexicon) OST230693 (lexicon)
OST211368 (lexicon) OST206933 (lexicon) OST141807 (lexicon) OST103639 (lexicon)
OST103531 (lexicon)
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18362
Vector Insertion
Chr 18: 67943716 - 67944540
Public Clones not available
Private Clones OST424960 (lexicon) OST124237 (lexicon) OST124141 (lexicon)
Severity of mutation (?) Insertion after 29% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28304
Vector Insertion
Chr 18: 67944753 - 67946809
Public Clones not available
Private Clones OST34466 (lexicon)
Severity of mutation (?) Insertion after 48% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000116622
Sequence
GGGGCGTGGCGCGCCGGGGCCGACGCGGGCGGGCAGGCGAGGGCCGACGTGCCGTACGTGCCTCCGCGGTGGTCCGGGGGCTGCGGGCCGCACCGCCGCC

CTCTCGGAGGCGGGCCCGGCAGACGGCGGCGGCCATGTTTGTGGCGCGCAGCATCGCGGCGGACCACAAGGACCTCATCCACGATGTGTCTTTCGACTTC

CACGGGCGCCGGATGGCCACCTGCTCCAGCGATCAGAGCGTCAAG - UNI11425 - - UNI19256 - GTGTGGGATAAGAGCGAGAGCGGAGACT

GGCATTGTACAGCTAGCTGGAAG - UNI1377 - ACACATAGTGGATCTGTATGGCGTGTGACGTGGGCTCATCCTGAATTTGGACAAGTTTTGGCTT

CCTGTTCTTTTGACCGAACAGCAGCTGTATGGGAAGAAATAGTGGGAGAATCAAACGATAAACTTCGAGGACAGAGTCACTGG - UNI18362 - GTG

AAGAGGACAACTCTAGTGGACAGCAGAACCTCTGTTACTGATGTGAAATTTGCTCCCAAACATATGGGTCTGATGTTGGCCACCTGTTCAGCAGATGGTA

TAGTAAGGGTCTACGAGGCTCCCGATGTGATGAACCTCAGCCAGTGGTCTCTGCAGCACGAGGTCTCGTGTAAGCTGTGCTGCAGCTGCATTTCCTGGAA

CCCTTCCAG - UNI28304 - CTCTCGTGCTCATCCCCCCATGATCGCTGTGGGAAGTGATGATAGCAGTCCAAATTCAATGGCCAAGGTTCAGATTT

TTGAATACAATGAAAATACCAG GAAATATGCGAAAGCTGAGACTCTTATGACAGTCACAGACCCCGTCCATGATATCGCGTTTGCTCCAAATTTGGGAA

GATCTTTCCACATCCTGGCAGTAGCAACCAAAGATGTAAGAATTTTCACATTAAAACCTCTGAG GAAAGAACTTACTTCCTCTGGTGGTCCAACAAAAT

TTGAAATCCATATTGTGGCTCAGTTTGATAATCATAATTCTCAGGTCTGGAGGGTGAGTTGGAACATAACAGGGACAGTCCTGGCGTCTTCAGGAGATGA

CGGCTGTGTTAGGTTGTGGAAAG CTAATTACATGGACAATTGGAAGTGTACTGGTATTTTGAAAGGTAACGGGAGCCCAGTAAATGGGAGTTCTCAGCT

GGGAAACTCAAATCCTTCACTGAGCTCAAATATTCCAAATCTTCAAAATTCATTAAATGGAACTTCTGCTAGCAGGTAGGCTCTTCTGTGGGAAAAACTA

GAAACCTCCTTCCCTGCCCCCATGCACACTTTTTATGTGTAGGGTGTTTTACCTGCTTGTATATCTCTGCTCCATAATGTGTGCAATGTTTGGGGAGGCC

AAAGAGTCAAGTGTTTTGGAAGTGGAGTTACGGATTCATGTGAGCCACCATGTGGGTGCTCAGAATCAAACCTGGGTCCTTTGCAAGAGCAGCCAGGGCC

CTTAATTGCTGAGCCACCTCTCCTGGTAGTCATACTAAAAGGTGAATTTTAAGATGGAATAAAGTAATTCACCAATAATTGTGACACTTACTCTTGGAAT

TTCACTCTTGTCTGTATTTAGTGGCTTCCTTGGTTATAGTATGGACAGTTTTTTAAGTCCATTGAATTATATTCTGGAATTCAGTGGTCAGTAAAAATGT

TAGTCGTTTTATGATTCTGTGTTCTTTTCTGCAGCAGTGAAAGGAGATGTTGTTTAATAGAGCTGACTCTTAGATAAATATTCGGATGTTTTTAGTGCCT

CTTGGGTAGGCTTTGTATCAAATCACATTGAAATTTTAAATAAAGTCCATAACT
Translation
MFVARSIAADHKDLIHDVSFDFHGRRMATCSSDQSVK - UNI11425 - - UNI19256 - VWDKSESGDWHCTASWK - UNI1377 - THSGSV

WRVTWAHPEFGQVLASCSFDRTAAVWEEIVGESNDKLRGQSHW - UNI18362 - VKRTTLVDSRTSVTDVKFAPKHMGLMLATCSADGIVRVYEAPD

VMNLSQWSLQHEVSCKLCCSCISWNPSS - UNI28304 - SSRAHPPMIAVGSDDSSPNSMAKVQIFEYNENTR RKYAKAETLMTVTDPVHDIAFAP

NLGRSFHILAVATKDVRIFTLKPLR RKELTSSGGPTKFEIHIVAQFDNHNSQVWRVSWNITGTVLASSGDDGCVRLWKA ANYMDNWKCTGILKGNGSP

VNGSSQLGNSNPSLSSNIPNLQNSLNGTSASR
Transcript ENSMUST00000025421
Sequence
GGCGGCCATGTTTGTGGCGCGCAGCATCGCGGCGGACCACAAGGACCTCATCCACGATGTGTCTTTCGACTTCCACGGGCGCCGGATGGCCACCTGCTCC

AGCGATCAGAGCGTCAAG - UNI11425 - - UNI19256 - GTGTGGGATAAGAGCGAGAGCGGAGACTGGCATTGTACAGCTAGCTGGAAG - U

NI1377 - ACACATAGTGGATCTGTATGGCGTGTGACGTGGGCTCATCCTGAATTTGGACAAGTTTTGGCTTCCTGTTCTTTTGACCGAACAGCAGCTG

TATGGGAAGAAATAGTGGGAGAATCAAACGATAAACTTCGAGGACAGAGTCACTGG - UNI18362 - GTGAAGAGGACAACTCTAGTGGACAGCAGA

ACCTCTGTTACTGATGTGAAATTTGCTCCCAAACATATGGGTCTGATGTTGGCCACCTGTTCAGCAGATGGTATAGTAAGGGTCTACGAGGCTCCCGATG

TGATGAACCTCAGCCAGTGGTCTCTGCAGCACGAGGTCTCGTGTAAGCTGTGCTGCAGCTGCATTTCCTGGAACCCTTCCAG - UNI28304 - CTCT

CGTGCTCATCCCCCCATGATCGCTGTGGGAAGTGATGATAGCAGTCCAAATTCAATGGCCAAGGTTCAGATTTTTGAATACAATGAAAATACCAG GAAA

TATGCGAAAGCTGAGACTCTTATGACAGTCACAGACCCCGTCCATGATATCGCGTTTGCTCCAAATTTGGGAAGATCTTTCCACATCCTGGCAGTAGCAA

CCAAAGATGTAAGAATTTTCACATTAAAACCTCTGAG GAAAGAACTTACTTCCTCTGGTGGTCCAACAAAATTTGAAATCCATATTGTGGCTCAGTTTG

ATAATCATAATTCTCAGGTCTGGAGGGTGAGTTGGAACATAACAGGGACAGTCCTGGCGTCTTCAGGAGATGACGGCTGTGTTAGGTTGTGGAAAG CTA

ATTACATGGACAATTGGAAGTGTACTGGTATTTTGAAAGGTAACGGGAGCCCAGTAAATGGGAGTTCTCAGCTGGGAAACTCAAATCCTTCACTGAGCTC

AAATATTCCAAATCTTCAAAATTCATTAAATGGAACTTCTGCTAGCAGG AAAGCACAGCTGAGTACAAGCTAGCTGGAGTAACTTTGCTGTTTTGCTGC

TTGTTGCATGCACACAGGAATGGAAATCAACTCCTTTTCCCCTTCCCCAGCGCCGTTTGATCTCTTCCAAGATGCACCAGCAGCCCGTTCACTACTACAC

ACAGTCCAAAAGGCCTTTAAAGTGACAGTGTATATAACTTTTGTACTAGTCAGCCTCCTGACACTATAAATGGAAAGGCTTTTTGTTGACACATCATCAC

CAAAACAATTTTTTGGGATGTTCTGGAGACTAACTTGGGAAAGCATTGCTATTATCCTCATAAGCATTTGGGAGGAGGGAAAATATAATTTTATTCCGTT

TGGAGAATATAGGAATATGTCTTTTATTTTCTAAAACAATAAGCTAAAATGATGAGTTTTTATAATTTTAATTTGAAAATCGAATAAATATTTTCTT
Translation
MFVARSIAADHKDLIHDVSFDFHGRRMATCSSDQSVK - UNI11425 - - UNI19256 - VWDKSESGDWHCTASWK - UNI1377 - THSGSV

WRVTWAHPEFGQVLASCSFDRTAAVWEEIVGESNDKLRGQSHW - UNI18362 - VKRTTLVDSRTSVTDVKFAPKHMGLMLATCSADGIVRVYEAPD

VMNLSQWSLQHEVSCKLCCSCISWNPSS - UNI28304 - SSRAHPPMIAVGSDDSSPNSMAKVQIFEYNENTR RKYAKAETLMTVTDPVHDIAFAP

NLGRSFHILAVATKDVRIFTLKPLR RKELTSSGGPTKFEIHIVAQFDNHNSQVWRVSWNITGTVLASSGDDGCVRLWKA ANYMDNWKCTGILKGNGSP

VNGSSQLGNSNPSLSSNIPNLQNSLNGTSASR KAQLSTS

For any suggestions or comments, please send an email to unitrap@crg.es