Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000079659 (4930420K17Rik)
Chromosomal location
Chr 5: 9100737 - 9118983 (+)
Description
RIKEN cDNA 4930420K17 gene Gene [Source:MGI Symbol;Acc:MGI:3606159]
Human Ortholog
not available
Omim not available
UniTrap UNI36854
Vector Insertion
Chr 5: 9101396 - 9116479
Public Clones IST11722H1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 22% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000115365
Sequence
CCGGACCGGAGAGCCCGGGGGGACTCGCCGCACGGCGCCGGCGTCCGGCCGGCGTGTGGGGGCCACGGCTCGGGGTCGCGGCCGCTGCCTGGATCCGCCG

CGCGCGCGGCGCGGGACGCCGAG GGCCCGGGCCATGCGTGCGCCGTGAGGGGCGGGCGTCCGGACTTCGCGAGCTGATGCGGACTCGCTTTTGAGCGTC

CGGGGACGAGCGAAGCAGCCCTAAAATGGAGGACTTTGCTACCAGGACCTACGGGACCAGCGGCCTGGATAACAGACCTCTGTTCGGGGAGACGTCTGCC

AAG - UNI36854 - GACCGAATCATCAATTTAGTTGTTGGCAGCTTAACCACCTTGTTGATTCTA GTCACACTGATCAGTGCTTTTGTGTTCCCTC

AACTACCTCCCAAACCACTGAATATATTTTTTGCTGTCTGCATCTCTTTGAGTAGTATTACTGCCTGCATACTT ATCTACTGGTATCGACAAGGAGACT

TAGAACCGAAATTTAGAAATCTAATTTACTATATCTTATTTTCTATCATCATGTTATGTATATGTGCAAACTTGTACTTCCATGATGTGGGAAGGTGAGG

CTGCAGAGACGAAATACTTACCAGGACTCTTGGAAATCTATGTGAATTTAACTGCTGCAAAAAAGTATGCTGAAGACTCATCGACAGACGTGTGGTACAT

GATGTTTCCATGTTAACTGTAAATCTCAATCCCCCCTGCGAGGGGGCTGCAGCATAGATCTCTGCTCTCCTTTAAAACGCCCACACATTCCAGCCCTCAA

ATAGCAAGGAATTCTCACTTTTGAAAGAATTTTTTTTTTTTGTTTTTGTTTTTTTTTTTTTTAACAATTTAATTGCATGGCTCAAAATCTTGCATTTTAA

GACAAATACTCTTTTATTTCTGTTAAACTGAATATACAATTATTGTTCCCCTAGGCAACCAACTTTTGCTTATTACTACAGTTTTACATTAATAAACAGA

TGGTG
Translation
 MEDFATRTYGTSGLDNRPLFGETSAK - UNI36854 - DRIINLVVGSLTTLLIL VTLISAFVFPQLPPKPLNIFFAVCISLSSITACIL IYWYR

QGDLEPKFRNLIYYILFSIIMLCICANLYFHDVGR

For any suggestions or comments, please send an email to unitrap@crg.es