Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000079662 (Ntn2l)
Chromosomal location
Chr 17: 24340793 - 24346332 (-)
Description
netrin 2-like (chicken) Gene [Source:MGI Symbol;Acc:MGI:1341188]
RefSeq_dna
NM_010947 
RefSeq_peptide
NP_035077.1 
UniGene
Mm.259542 Mm.411096 
MGI
MGI:1341188 
Uniprot/SWISSPROT
Q9R1A3 
Uniprot/SPTREMBL
Q52KG2 
Human Ortholog
ENSG00000162068 (NTN2L)
Omim not available
UniTrap UNI33110
Vector Insertion
Chr 17: 24344510 - 24344933
Public Clones IST13135G12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 64% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32502
Vector Insertion
Chr 17: 24340792 - 24344228
Public Clones IST14408D11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 80% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000024931
Sequence
CTCGCTGCAGCCAGGAGAAGCCGGCAGCCCGGGCGCCCCAGGCCCCGCCCGCCCAAGGCCCTTCCCGGGAGGCCGGGAGACCTGCTCCTCCTGGCCCTCC

GTGGGTGAGTGCTGGCGGCCGGCGGCGGGTGGGGCCTCCGCGGGCGGAGGCACCGGGAGCGGGGGCGACGCCTGTCAACGCTTCAGGCCTAGCAGGAGGA

CTCGCCAACATCCCTGCTCCTGTGCTCGGCCCCGGGCGTGCCGGTGGCTGCTCCCACTTCTGGGCCTGTGCTGGGGGCCGCCCTGGTGCTCTGCTATCTT

GGCACTGCAGACCCGGCACGCAGAGTAGCGGACTAGGCTCTCTCTTCGAGGGCAGACTCGTTAGGCGGAAGCTGGCTGGTTGACTTACAGCGGCCACGGC

CATGCCCACCTGGCTCTGGGGGCTGCTGCTGACCGCGGGCACGCTCTCCGCTGCACTGAGCCCAGGGCTGCCGGCCTCTGCCGACCCCTGCTATGATGAG

GCGAGGGAGCCTCGCTCTTGTATTCCTGGCCTTGTGAACGCTGCTCTGGGCCGAGAGGTGCTGGCGTCCAGCACGTGCGGGAGGTCGGCCAATCGCGTCT

GCGATTCCTCGGACCCGCAGCGGGCACACTCTGCAGACCTCCTGACCTCTGCTCCGGGCACTGCAAGTCCTCTCTGTTGGCGCTCCGATTTGCTGCAACA

GGCACCTTTCAACGTAACCCTCACAGTGCCCCTGGGGAAGGCTTTTGAGCTGGTCTTCGTGAGCCTGCGCTTCTGCTCAGCTCCTCCAACCTCCGTGGCC

CTGCTTAAGTCGCAGGACCATGGCCGCAGCTGGGTCCCCTTGGGCTTCTTCTCTTCCAGCTGTACCCTGGACTATGGCCGTCTGCCTGCTCCTGCTGATG

GCCCTTCTGGTCCAGGGCCAGAAGCCCTCTGCTTTCCAGCCCCCCAGGCTCAGCCTGATGGTGGAGGCCTTCTGGCCTTCAGTGTGCAGGATGGCAGCCC

ACAGGGCCTGGATCTGGACAACAGCCCCGTGCTCCAAGACTGGGTGACTGCCACAGATATTCGCATAGTACTCACAAGGCCTGCCATTCAGGGAGACACC

AGGGACGGTGGGGTGACAGTCCCCTACTCCTACTCAGCCACTGAGCTTCAGGTGGGAGGTCGATGCAAGTGCAATGGGCATGCCTCACGGTGTCTGTTGG

ACACCCATGGCCACCTGGTCTGCGACTGCCAGCATGGTACAGAGGGCCCTGATTGCAGCCGCTGCAAGCCCTTCTACTGCGACAGGCCATGGCAGCGGGC

TACAGGGCAGGAAGCCCACGCTTGCCTTG - UNI33110 - CTTGCTCCTGCAACGGCCATGCGCGAAGATGCCGCTTCAACATGGAGCTCTACCGAC

TGTCCGGCCGCCGCAGTGGGGGCGTGTGCCTCAACTGCCGGCACAATACAGCTGGTCGTCACTGCCACTACTGCCGGGAGGGCTTCTATCGTGATCCAGG

CCGTGTCCTGAGTGACCGTCGTGCTTGCAGAG - UNI33110 - CTTGTGACTGCCACCCAGTTGGTGCTGCTGGCAAAACCTGTAACCAGACCACAG

GCCAGTGTCCCTGTAAGGATGGTGTTACTGGCCTCACCTGTAACCGCTGTGCCCCAGGTTTCCAGCAGAGCCGTTCTCCTGTGGCACCTTGCGTTA - U

NI33110 - AGACTCCTGTCCCTGGACCCACCGAAGAAAGCAGTCCTGTGGAGCCACAGG - UNI32502 - ACTGTGAGTCACATTGCAGACCTGC

GCGTGGCAGTTACCGAATCAGCCTGAAGAAGTTCTGCCGGAAGGACTATG - UNI32502 - CGGTGCAGGTGGCAGTGGGTGCACGCGGTGAGGCCC

GCGGCTCGTGGACACGCTTTCCGGTAGCGGTGCTTGCTGTGTTCCGCAGCGGCGAGGAACGCGCTCGACGCGGGAGCAGCGCGCTGTGGGTACCAACTCT

AGACGCGGCCTGCGGTTGCCCGCGCCTCCTGCCCGGCCGGCGTTACTTGCTGCTGGGAGGTGGGCCGGGGGCTGCAGCTGGGAGCACAGCGGGCCGGGGA

CAGGGGCTCAGTGCTGCCCGTGGAAGCCTCGTGCTGCCTTGGAGAGACGCCTGGACCCGGCGCCTGCGGAGGCTGCAGAGGAGAGAGCGGCGGGGGCGCT

GCGGGACCGCCTGAATCTGCAAGCTGGGCGTGGACTGGGCGGACTCAGCTCTCTTATCACTGGGCGCGGCGCGTTCATCAGAGCACTAGGCTGGAAGTGT

CACGTGCATCGCCATCTAATTTCCCCCTACCCCCATCCCCGCTTGAAACCTATTTGGCGATACCCTACCCCCAACTTAGAGGAGTATGATGGCCCCTAAG

AGCTATCTGGAGGCTCCTAGGGCAGCTCAGAGGACCCTGATCTTATCCCTCTTGGCTGATACCCGACGTCTCTTAAAGGTGTGAACCCGCCTATTCCCAG

GGGATGCTAGGATGATCCCTCTGGGGTTTGAGCACATCCCACGGGCCAATGTGATTCATCAACTCTCTGATGCTGTGATACACTAGAGTTCTCCAACCTC

TCCAAAACCACTGTTGCCACCATAATTGCCTGTACACCGCTGCAGGGGCTGTGGCTCAATTGCACAGCCAAGACAGCGACGTCTCTGCCCTCCAGCCGGG

AATGTACAAAGAGTATTGTAGGCTCCCCTGTCCAGTGTCATGGATCTTGTCCCCATATCCATTCTGGCCTGCCTCTGCCGGTCACGTGACCGTGTCCCCA

TCCGCAGCTGCATCACTGCCTGTGTCCCATATCTTTCTTGTTCCGTTGTACCCTTTTCTGGGGTCCATCCAGCTGTCGCTTTCTACCACGACTCCTACCA

GTCTTGGCCTCTTGGCTCCATGACACAGGTCCTGCCCCTAGCTAGGAGCCCTACACTCTATCCGCTCAAGACTGGACGTCGAGAAGGGGCAGATCAGGTC

CACGTGTGACCGGACCAGAGGCGACTTCCACGGGCAGCCGTCGGAGTTCTAGTCGTCCGTGACTTTGCCTTACACCAGGCGCTAGGGTCCCCACCTCTTT

AGGCGAGCCCCCGCCCCTTAGCGCGGGAACCGCTGTTTGGCTAGCGCATGCTCCCGACTTGGCCGCCGCCGGGCGCAAATGCGCATGCTCAGAGCCGGCA

GCACTGAGACGCGGGGCACTCGGGGTGGGCAGCCCGCAAGCGCGTGCTTGTGGGGCGGGGCCGCCTACGCGCGTGCGCAGAAAGTCCAGTGCGGTCCAGC

GGAGAGCCGAAGGGAGAGGTGCGGTGCGGCGCGCCGAGGTGGGTGCGCGGCGGGGGCGTGGCGGCTGGACGCGGGGTGTGGGGGTGTCACTGCCACGGTG

CGCTGACCGGCGGCACGGATGTACTGAGGGAGGGGGGCACGGGTTGTGCTCCGTGTCTTGGTCGCTGCGGGTTAGGGGGCTCCAGAGTCTAATGCTGCGT

GCGTGACGTGGGCCCCGGAGTCAGAACCCTTTGGGCAGGCCCGGCTTTCCTCGATCATCCCTGCCTTCTCTGGGCTCTGTGTCGTGGGCAAGAACTGCCT

CTGTGTCAACCTTCCCTTGGGGCACTTTCCGTCCCTGCGGAATAGGAAATCCTCTTTCTGTATTCGTTCGAAATTGCAGCAGTGTTCATATACCTTTGCC

CTCGGAGACCTGCAACAACCCAGGCCCTTCACTTGCCAAAGATGACACAACTGCCCACCTGAAGCTTAGGGACTTTCCCAGCCTGAGAGCCCTATCCAGC

CAGTGTCCCTGACATGCCTTGGTCACCTGTGCCTTAGCTTGGCCCTGTGCTTCAGGAGTTTTGAATAACAGCTGGAGGGCAGAGCTGGCACCACACGGGG

TGGGCTGCACATGACAGAAGTCAGTCTGCTGGGTGCTGGCAGCCTGACCACAGATTTTCCTTGACAGACCTGACTCAGTTCAGAAATAGTGCTCTGGCCT

TCTTGGATGGGGACTCACTGGGCTAACTTTAAAGGCCAAAGATTGTCTAGCCCAGCCCGGACATATGCAGGCATAGGTTGGCCATTTGGGCGGTTGTGTT

GCTGTCTTTCCAAGGTAAATAAAGGATTTTCCTTGTCTCACCATGTTCTGCTGGAAGGTCAGCAAGCTACTCCCAGGCAGTTGGTACAACTGTCCCATGG

CATGCGTTGCCATGTCATCTACTTGGGGACAATGACTCCATTCTCATTTTCACACCCCTGTCCCCAATAGGCACCTGTCATTGTTCACTGAATTGTTGTG

GAGATGGCTGTATTTGTGTTCTCTCAAGCTCTATCTGATGTCAGTTCTGGGTTGGTGTCAAGACCAACCCAGACGACAAATGGTTAAGAAATTTCAAATA

TTTGATAGTGACCATTCATATTGAGTGCTATGAGGGCTCTGTGTGCTTCCTTGATGATTAATCCTCACCTAATCTCCCCAGTACTCAGATAAAGACTTAG

GGTAGTGACAGCTGTATTTAGAATCTAGTCTGCGTGTGGATAGGCCTGGAGCCACATCGTGTTGTCCCTGTTCCCCCATGGTCTGGCATTCAGTTAGCCA

GGCACTCTCTTAAGTGCTTGTTGGAGGGAATAAAGATGCCACTTTTTGAATGCTACATGTCAACTAGTGAACTAGCAATGTAGTGGCTTTTGGCTGGATT

AAGGGTGACCTTTTGGGTTTGCAGAAGTACTCTAGTAATCTAGGTAGGGTTTTCATAACAACAATCAAATTTACCTCCCTGGGAGTGCAAACTCACCTGC

CTGTGTTCCCTACTAGCTCTGAGTAACCACCCTTGCCAGGACTGTCTGGCAAGTCTCAGTGACCTTGGGCACACAGCATTGCTCCTAATCCTTATTAGAG

ACTGAGCCAACCTCTGAAGACATAGTAAAGTGTTTAAAGTACACAAGACAATGAAGTGGGTTGT
Translation
MPTWLWGLLLTAGTLSAALSPGLPASADPCYDEAREPRSCIPGLVNAALGREVLASSTCGRSANRVCDSSDPQRAHSADLLTSAPGTASPLCWRSDLLQQ

APFNVTLTVPLGKAFELVFVSLRFCSAPPTSVALLKSQDHGRSWVPLGFFSSSCTLDYGRLPAPADGPSGPGPEALCFPAPQAQPDGGGLLAFSVQDGSP

QGLDLDNSPVLQDWVTATDIRIVLTRPAIQGDTRDGGVTVPYSYSATELQVGGRCKCNGHASRCLLDTHGHLVCDCQHGTEGPDCSRCKPFYCDRPWQRA

TGQEAHACLA - UNI33110 - ACSCNGHARRCRFNMELYRLSGRRSGGVCLNCRHNTAGRHCHYCREGFYRDPGRVLSDRRACRA - UNI33110 

- ACDCHPVGAAGKTCNQTTGQCPCKDGVTGLTCNRCAPGFQQSRSPVAPCVK - UNI33110 - KTPVPGPTEESSPVEPQD - UNI32502 - D

CESHCRPARGSYRISLKKFCRKDYA - UNI32502 - AVQVAVGARGEARGSWTRFPVAVLAVFRSGEERARRGSSALWVPTLDAACGCPRLLPGRRY

LLLGGGPGAAAGSTAGRGQGLSAARGSLVLPWRDAWTRRLRRLQRRERRGRCGTA

For any suggestions or comments, please send an email to unitrap@crg.es