Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000079709 (AC182749.2-203)
Chromosomal location
Chr 17: 15115829 - 15127768 (+)
Description
Putative uncharacterized protein  [Source:UniProtKB/TrEMBL;Acc:Q8C5D3]
RefSeq_peptide
NP_001116842.1 
Uniprot/SPTREMBL
Q8C9C8 Q8C5D3 
Human Ortholog
ENSG00000130023 (C6orf70)
Omim not available
UniTrap UNI14595
Vector Insertion
Chr 17: 15115864 - 15116464
Public Clones (sanger) FHCRC-GT-S17-12D1 (fhcrc) PST22931-NR (escells) IST14652G7 (tigm)
IST10459B1 (tigm) IST10772B9 (tigm) IST11320A5 (tigm)
Private Clones OST431255 (lexicon) OST420187 (lexicon) OST338180 (lexicon) OST309374 (lexicon)
OST307992 (lexicon) OST278820 (lexicon) OST263048 (lexicon) OST225410 (lexicon)
OST205325 (lexicon) OST198851 (lexicon) OST186099 (lexicon) OST126189 (lexicon)
OST86214 (lexicon) OST82248 (lexicon) OST64185 (lexicon) OST49179 (lexicon)
OST38647 (lexicon) OST32766 (lexicon) OST32764 (lexicon)
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14648
Vector Insertion
Chr 17: 15116634 - 15117221
Public Clones (sanger) FHCRC-GT-S3-6F1 (fhcrc) IST13291E9 (tigm) IST10955C10 (tigm)
IST11754C5 (tigm) IST14149C6 (tigm) IST10813D11 (tigm) IST14716B2 (tigm)
IST12713E6 (tigm) IST10735G1 (tigm) IST15104H6 (tigm) IST12541G10 (tigm)
Private Clones OST353699 (lexicon) OST331153 (lexicon) OST327913 (lexicon) OST298589 (lexicon)
OST288767 (lexicon) OST231559 (lexicon) OST190673 (lexicon) OST181516 (lexicon)
OST159028 (lexicon) OST126913 (lexicon) OST109525 (lexicon) OST102814 (lexicon)
OST101089 (lexicon)
Severity of mutation (?) Insertion after 34% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16831
Vector Insertion
Chr 17: 15117362 - 15118539
Public Clones E115A05 (ggtc)
Private Clones OST453572 (lexicon) OST301817 (lexicon) OST275577 (lexicon) OST126204 (lexicon)
Severity of mutation (?) Insertion after 60% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22169
Vector Insertion
Chr 17: 15118642 - 15119263
Public Clones IST12266G10 (tigm) IST11661G7 (tigm)
Private Clones OST305142 (lexicon) OST185774 (lexicon)
Severity of mutation (?) Insertion after 80% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31526
Vector Insertion
Chr 17: 15121880 - 15122737
Public Clones IST14294A10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32017
Vector Insertion
Chr 17: 15123797 - 15124559
Public Clones IST10749G8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34077
Vector Insertion
Chr 17: 15125068 - 15125861
Public Clones IST10826G3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1957
Vector Insertion
Chr 17: 15125931 - 15127510
Public Clones BA0292 (sanger) AN0531 (sanger) AT0124 (sanger) AL0288 (sanger)
AX0430 (sanger) AM0572 (sanger) AN0059 (sanger) AS0220 (sanger)
(sanger) AS0371 (sanger) AY0395 (sanger) AM0208 (sanger) CSG190 (baygenomics)
IST14949C9 (tigm) IST10582D4 (tigm) IST13257H5 (tigm) IST12054B2 (tigm)
IST10359E2 (tigm) IST12327C9 (tigm) IST11503H3 (tigm) IST10199E6 (tigm)
IST11017A6 (tigm) IST12753G12 (tigm) IST13935F2 (tigm) IST10164D11 (tigm)
IST11675C5 (tigm) IST14710F2 (tigm) IST12078A1 (tigm) IST10025G12 (tigm)
IST10819D6 (tigm) IST11901C7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000087433
Sequence
AGAGAGCGCCGCGACCCGAGCCGGAAGCGATGGAG - UNI14595 - ATTTTACCAGGGGATTCCATGACCACATGCCTTTCTCCTTTAGTGCATGAC

TTGATTTGTAACCTTGGGTTTGAACTCAAAGAAATTTGTGATATCAATAGCATTGTAACTCAAAATGGTGAAGTACGATGGAAAGCAATTACTGACCGTG

TGAGATATGAAGAATTAG - UNI14648 - GGCGAAGTCTGGACTACAGGAGAAGTGTGCAGCAGCTGGGTCCGGTGTGTGAGGCCATCCACCTACAC

ATCTCAGCTCTGACCAGGGCTCAGTTTGAAATTCAGTATTCGCCTTGGTACCAGTGGACAACTTATCCAGAG - UNI16831 - TTGTTTCTTGAGAT

ACTTGATGCCTTGCAAAGCTCGCAGCCTGCTGCCGTCTCCCTCGGCGTGATGAAACTAGCTTCCTGTCTGGAGCGAGCCCTCGGCGAC - UNI22169 

- GTATTTTTACTGGTTGGGAAAGAGTGCCCCTTTCTCCTAAGAGATCTTCTTGCATCTGCAGAGCTTGCACAAGTCTTTGGACATGCTGTG AATATTC

TAGAGGAACTGTAA
Translation
ME - UNI14595 - ILPGDSMTTCLSPLVHDLICNLGFELKEICDINSIVTQNGEVRWKAITDRVRYEELG - UNI14648 - GRSLDYRRSVQQL

GPVCEAIHLHISALTRAQFEIQYSPWYQWTTYPE - UNI16831 - LFLEILDALQSSQPAAVSLGVMKLASCLERALGD - UNI22169 - VFLL

VGKECPFLLRDLLASAELAQVFGHAV NILEEL
Transcript ENSMUST00000097395
Sequence
AGAGAGCGCCGCGACCCGAGCCGGAAGCGATGGAG - UNI14595 - ATTTTACCAGGGGATTCCATGACCACATGCCTTTCTCCTTTAGTGCATGAC

TTGATTTGTAACCTTGGGTTTGAACTCAAAGAAATTTGTGATATCAATAGCATTGTAACTCAAAATGGTGAAGTACGATGGAAAGCAATTACTGACCGTG

TGAGATATGAAGAATTAG - UNI14648 - GGCGAAGTCTGGACTACAGGAGAAGTGTGCAGCAGCTGGGTCCGGTGTGTGAGGCCATCCACCTACAC

ATCTCAGCTCTGACCAGGGCTCAGTTTGAAATTCAGTATTCGCCTTGGTACCAGTGGACAACTTATCCAGAG - UNI16831 - TTGTTTCTTGAGAT

ACTTGATGCCTTGCAAAGCTCGCAGCCTGCTGCCGTCTCCCTCGGCGTGATGAAACTAGCTTCCTGTCTGGAGCGAGCCCTCGGCGAC - UNI22169 

- GTATTTTTACTGGTTGGGAAAGAGTGCCCCTTTCTCCTAAGAGATCTTCTTGCATCTGCAGAGCTTGCACAAGTCTTTGGACATGCTGTG ATGGACA

TACTAAAAGTCTTCATCGGGTCTCCCTGCGGACTCAACCTGAGAAACGTCTTGTGGCATGGCTTTGCTTCCCCTCAAGATATTCCTCCAAA - UNI315

26 - ATACTGTTCAGCCATGTTGCTGTTGACGGCAGGACTGGGCCAGTTACTGAAGAGTTACCTTCACCACACAAAGGTCACCTTGGCACATCGACCTT

TTGTAACACTCACAAACTTAGAGGATGTGATTGTTTTTCCTG GTGTGACTTATGAGGTACTGTCAGCATTAGAGACAGTGATGACAAAATCCAACTTCC

TATTAAAAATCATGTTGCCATATTGGGAAATGGCAGTGAGCAAGTTCAAGTCGCACAG - UNI32017 - GTTTGCCGACTACACCATGTTGTTGCTG

TCACAGCTAGAAGCTGGACTCAGGAGACTGTTTGCTGCAGTTAACAAGTGTCCTGATAGACTGCTCACAGCCGAG TCAACAATTCTATATACCACGTTT

GATGAA - UNI34077 - ATACTGGCAAAACACATGAGTGATGGTAGCATGAACCAGCTTCCTTGTTTCCTTGGAGAGCCTGCCATG - UNI1957 

- GAATTCTTGTGGGATTTCCTGAACTATCAGGAGGGTCCTCGTATCCGGGATCATTTAAGCCATGGGGAGATCAACATACGTGAATTTCCAGAAGAGGC

CGCAGGCCAGCTGCTCACATTCTCCCTGGTGCTGCTGCTCAGATTCACTGAGAAGGGGACAGTGTCAGAACTGAAGGTACCACAGAGGGAGGGAGGAGGG

TGGCTGGCGGAATGTACTACCACCAGCAAGGGAAGAGCATGTCTTATTTCTCAAATTTGA
Translation
ME - UNI14595 - ILPGDSMTTCLSPLVHDLICNLGFELKEICDINSIVTQNGEVRWKAITDRVRYEELG - UNI14648 - GRSLDYRRSVQQL

GPVCEAIHLHISALTRAQFEIQYSPWYQWTTYPE - UNI16831 - LFLEILDALQSSQPAAVSLGVMKLASCLERALGD - UNI22169 - VFLL

VGKECPFLLRDLLASAELAQVFGHAV MDILKVFIGSPCGLNLRNVLWHGFASPQDIPPK - UNI31526 - KYCSAMLLLTAGLGQLLKSYLHHTKV

TLAHRPFVTLTNLEDVIVFPG GVTYEVLSALETVMTKSNFLLKIMLPYWEMAVSKFKSHR - UNI32017 - RFADYTMLLLSQLEAGLRRLFAAVN

KCPDRLLTAE STILYTTFDE - UNI34077 - ILAKHMSDGSMNQLPCFLGEPAM - UNI1957 - EFLWDFLNYQEGPRIRDHLSHGEINIREF

PEEAAGQLLTFSLVLLLRFTEKGTVSELKVPQREGGGWLAECTTTSKGRACLISQI

For any suggestions or comments, please send an email to unitrap@crg.es