Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000079732 (100040531)
Chromosomal location
Chr 17: 6600835 - 6609656 (+)
Description
dynein light chain Tctex-type 1F Gene [Source:MGI Symbol;Acc:MGI:3780996]
MGI
MGI:3780996 
Uniprot/SPTREMBL
Q9DAS3 
Human Ortholog
ENSG00000146425 (DYNLT1)
Omim not available
UniTrap UNI38179
Vector Insertion
Chr 17: 6603425 - 6606506
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 21% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000115770
Sequence
TGGTAGTGGTCAGGGTCCCCCGCGCGGGGGCGGAGTGGGCGTGTTCTGGCCGCGCCTGCGCAGTCCACTCTACTCGGCGGGCGAAGGAGACGCGTTAAAG

ATGGAAGACTTCCAGGCCTCCGAGGAG ACTGCATTTGTTGTTGATGAAGTGAGCAGCATTGTAAAGGAG - UNI38179 - GCTATAGAAAGCGCCA

TCGGTGGTAATGCCTACCAGCACAGCAAAGTCAACCAGTGGACCACTAATGTCCTAGAACAGACTTTGAGCCAACTCACCAAACTGGGGAGACCATTTAA

ATACATTG TGACCTGTGTGATCATGCAGAAGAACGGTGCTGGGTTACACTCCGCAAGTTCCTGCTTCTGGGACAGCTCCACAGACG TAAAACCCTGTT

GCGGCCGGCCTGCAGCTTGCAACGAACGGTTCAGCTGA
Translation
MEDFQASEE TAFVVDEVSSIVKE - UNI38179 - AIESAIGGNAYQHSKVNQWTTNVLEQTLSQLTKLGRPFKYIV VTCVIMQKNGAGLHSASSC

FWDSSTDV VKPCCGRPAACNERFS

For any suggestions or comments, please send an email to unitrap@crg.es