Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000079844 (Mkl2)
Chromosomal location
Chr 16: 13256599 - 13333015 (+)
Description
MKL/myocardin-like 2 Gene [Source:MGI (curated);Acc:Mkl2-004]
RefSeq_dna
NM_181860 
RefSeq_peptide
NP_862908.1 
Uniprot/SPTREMBL
Q8R2L3 
Human Ortholog
not available
Omim not available
UniTrap UNI1450
Vector Insertion
Chr 16: 13265233 - 13326474
Public Clones CD0600 (sanger) RRU238 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24534
Vector Insertion
Chr 16: 13265233 - 13326474
Public Clones IST14162D2 (tigm) IST10060F5 (tigm)
Private Clones OST216250 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5331
Vector Insertion
Chr 16: 13326665 - 13332106
Public Clones CSH258 (baygenomics) SYA383 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 50% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000115809
Sequence
GGTGGTAGCTGCGGCAGCGGTGGCGGCGGCGGCGGCAGCGGCCGGGGAG GTTCATAATTAAGGTGCTAAGGAAGAGAATGTAAGACAGGAAAATAAATA

TTTTTACTGAG - UNI1450 - - UNI24534 - GCTGCGTAAAAGAGGTGTCTCAGTGGCTGGAACACAATGGATCACACAGGAGCCATAGACACA

GAGGAAGAGCTGGGGCCTCTAGCCCATCTTGCACCAAGTCCTCAAAGTGAGTCTGTGGCTCACGAATTCCAGGAACTGTCTCTACAGTCCAGCCAGCACT

TACCCACTCTGAACGAACGGAAAAATG - UNI5331 - GAAGTATAGTCTTTGGGGAGTCAGGACTGCAGCTTCCTCTGCCGGCTCAGTCTGTGAGCA

CAG GACATAATAAGAAAAGCAAGAAGCCTCATTTGCCACTAGTCTTGGGTTCCTGCAGGCTGCATTTAGAACCTGCCAGGTGTTTGGATGGTTGACAAG

CTGCAGACTGGGAAGTTGATAGCAACAAAATTAGAACACTACCTGGAATAGACGCCTCCTCCTGACAGGGCAACTGTGCTGCTTGCTGACTGTGCAGCTT

GCCCAGCCTCTCATGGAATACTGCACTTAAAAACAGTCAGTCCACATCTCTCATGGTGTTGAAAATTGGCACTTCGAGGATAGAAATAAAGATACTTTTC

TTTTTACA
Translation
  - UNI1450 - - UNI24534 - MDHTGAIDTEEELGPLAHLAPSPQSESVAHEFQELSLQSSQHLPTLNERKNG - UNI5331 - GSIVFGES

GLQLPLPAQSVSTG GHNKKSKKPHLPLVLGSCRLHLEPARCLDG
Transcript ENSMUST00000056715
Sequence
CAGGTTCATAATTAAGGTGCTAAGGAAGAGAATGTAAGACAGGAAAATAAATATTTTTACTGAG - UNI1450 - - UNI24534 - GCTGCGTAAA

AGAGGTGTCTCAGTGGCTGGAACACAATGGATCACACAGGAGCCATAGACACAGAGGAAGAGCTGGGGCCTCTAGCCCATCTTGCACCAAGTCCTCAAAG

TGAGTCTGTGGCTCACGAATTCCAGGAACTGTCTCTACAGTCCAGCCAGCACTTACCCACTCTGAACGAACGGAAAAATG - UNI5331 - GAAGTAT

AGTCTTTGGGGAGTCAGGACTGCAGCTTCCTCTGCCGGCTCAGTCTGTGAGCACAG GACATAATAAGAAAAGCAAGAAGCCTCATTTGCCACTAGTCTT

GGGTTCCTGCAGGCTGCATTTAGAACCTGCCAGGTGTTTGGATGGTTGACAAGCTGCAGACTGGGAAGTTGATAGCAACAAAATTAGAACACTACCTGGA

ATAGACGCCTCCTCCTGACAGGGCAACTGTGCTGCTTGCTGACTGTGCAGCTTGCCCAGCCTCTCATGGAATACTGCACTTAAAAACAGTCAGTCCACAT

CTCTCATGGTGTTGAAAATTGGCACTTCGAGGATAGAAATAAAGATACTTTTCTTTTT
Translation
 - UNI1450 - - UNI24534 - MDHTGAIDTEEELGPLAHLAPSPQSESVAHEFQELSLQSSQHLPTLNERKNG - UNI5331 - GSIVFGESG

LQLPLPAQSVSTG GHNKKSKKPHLPLVLGSCRLHLEPARCLDG

For any suggestions or comments, please send an email to unitrap@crg.es